OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PROP1 (NM_006261) Human Mass Spec Standard

Be the first to review this product
SKU
PH318746
PROP1 MS Standard C13 and N15-labeled recombinant protein (NP_006252)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA343595 Rabbit Polyclonal Anti-PROP1 Antibody
100 ul
$585.00
LY416763 Transient overexpression lysate of PROP paired-like homeobox 1 (PROP1) (as WB positive control) 100 ug
$436.00

Other products for "PROP1 or NM_006261"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218746
Predicted MW 25 kDa
Protein Sequence
Protein Sequence
>RC218746 protein sequence
Red=Cloning site Green=Tags(s)

MEAERRRQAEKPKKGRVGSSLLPERHPATGTPTTTVDSSAPPCRRLPGAGGGRSRFSPQGGQRGRPHSRR
RHRTTFSPVQLEQLESAFGRNQYPDIWARESLARDTGLSEARIQVWFQNRRAKQRKQERSLLQPLAHLSP
AAFSSFLPESTACPYSYAAPPPPVTCFPHPYSHALPSQPSTGGAFALSHQSEDWYPTLHPAPAGHLPCPP
PPPMLPLSLEPSKSWN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006252
RefSeq Size 1464
RefSeq ORF 678
Synonyms CPHD2; PROP-1
Locus ID 5626
UniProt ID O75360
Cytogenetics 5q35.3
Summary This gene encodes a paired-like homeodomain transcription factor in the developing pituitary gland. Expression occurs prior to and is required for expression of pou domain transcription factor 1, which is responsible for pituitary development and hormone expression. Mutations in this gene have been associated with combined pituitary hormone deficiency-2 as well as deficiencies in luteinizing hormone, follicle-stimulating hormone, growth hormone, prolactin, and thyroid-stimulating hormone. provided by RefSeq, Sep 2011
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PROP1" proteins (3)
SKU Description Size Price
LC416763 Lyophilized PROP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416763 Transient overexpression lysate of PROP paired-like homeobox 1 (PROP1) (as WB positive control) 100 ug
$436.00
TP318746 Recombinant protein of human PROP paired-like homeobox 1 (PROP1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products