OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MRAP (NM_206898) Human Mass Spec Standard

Be the first to review this product
SKU
PH318683
MRAP MS Standard C13 and N15-labeled recombinant protein (NP_996781)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA356588 MRAP Antibody - N-terminal region
100 ul
$585.00
LY404158 Transient overexpression lysate of melanocortin 2 receptor accessory protein (MRAP), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "MRAP or NM_206898"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218683
Predicted MW 11.3 kDa
Protein Sequence
Protein Sequence
>RC218683 representing NM_206898
Red=Cloning site Green=Tags(s)

MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLILLYMSWSASPQMSF
NTDESLLHSEVLPQTRAISCDELQAPREEGAA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_996781
RefSeq Size 656
RefSeq ORF 306
Synonyms B27; C21orf61; FALP; FGD2; GCCD2
Locus ID 56246
UniProt ID Q8TCY5
Cytogenetics 21q22.11
Summary This gene encodes a melanocortin receptor-interacting protein. The encoded protein regulates trafficking and function of the melanocortin 2 receptor in the adrenal gland. The encoded protein can also modulate signaling of other melanocortin receptors. Mutations in this gene have been associated with familial glucocorticoid deficiency type 2. Alternatively spliced transcript variants have been described. provided by RefSeq, Dec 2009
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MRAP" proteins (3)
SKU Description Size Price
LC404158 Lyophilized MRAP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404158 Transient overexpression lysate of melanocortin 2 receptor accessory protein (MRAP), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP318683 Purified recombinant protein of Homo sapiens melanocortin 2 receptor accessory protein (MRAP), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products