OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MRAP (NM_206898) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP318683
Purified recombinant protein of Homo sapiens melanocortin 2 receptor accessory protein (MRAP), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA356588 MRAP Antibody - N-terminal region
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "MRAP or NM_206898"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC218683 representing NM_206898
Red=Cloning site Green=Tags(s)

MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLILLYMSWSASPQMSF
NTDESLLHSEVLPQTRAISCDELQAPREEGAA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 11.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_996781
Locus ID 56246
UniProt ID Q8TCY5
Cytogenetics 21q22.11
RefSeq Size 656
RefSeq ORF 306
Synonyms B27; C21orf61; FALP; FGD2; GCCD2
Summary This gene encodes a melanocortin receptor-interacting protein. The encoded protein regulates trafficking and function of the melanocortin 2 receptor in the adrenal gland. The encoded protein can also modulate signaling of other melanocortin receptors. Mutations in this gene have been associated with familial glucocorticoid deficiency type 2. Alternatively spliced transcript variants have been described. provided by RefSeq, Dec 2009
Protein Categories Endocrine and metabolic diseases, Membrane Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MRAP" proteins (3)
SKU Description Size Price
PH318683 MRAP MS Standard C13 and N15-labeled recombinant protein (NP_996781) 10 ug
$3,360.00
LC404158 Lyophilized MRAP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404158 Transient overexpression lysate of melanocortin 2 receptor accessory protein (MRAP), transcript variant 2 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products