OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DYNLT1 (NM_006519) Human Mass Spec Standard

Be the first to review this product
SKU
PH318331
DYNLT1 MS Standard C13 and N15-labeled recombinant protein (NP_006510)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY401953 Transient overexpression lysate of dynein, light chain, Tctex-type 1 (DYNLT1) (as WB positive control) 100 ug
$436.00

Other products for "DYNLT1 or NM_006519"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218331
Predicted MW 12.3 kDa
Protein Sequence
Protein Sequence
>RC218331 representing NM_006519
Red=Cloning site Green=Tags(s)

MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIM
QKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006510
RefSeq Size 713
RefSeq ORF 339
Synonyms CW-1; TCTEL1; tctex-1; TCTEX1
Locus ID 6993
UniProt ID P63172
Cytogenetics 6q25.3
Summary This gene encodes a component of the motor complex, cytoplasmic dynein, which transports cellular cargo along microtubules in the cell. The encoded protein regulates the length of primary cilia which are sensory organelles found on the surface of cells. The protein encoded by this gene interacts with viral proteins, like the minor capsid protein L2 of human papillomavirus, and is required for dynein-mediated delivery of the viral nucleic acid to the host nucleus. This protein interacts with oncogenic nucleoporins to disrupt gene regulation and cause leukemic transformation. Pseudogenes of this gene are present on chromosomes 4 and 17. Alternative splicing results in multiple transcript variants encoding different isoforms. provided by RefSeq, Apr 2014
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DYNLT1" proteins (3)
SKU Description Size Price
LC401953 Lyophilized DYNLT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401953 Transient overexpression lysate of dynein, light chain, Tctex-type 1 (DYNLT1) (as WB positive control) 100 ug
$436.00
TP318331 Recombinant protein of human dynein, light chain, Tctex-type 1 (DYNLT1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products