DYNLT1 (NM_006519) Human Tagged ORF Clone

SKU
RC218331
DYNLT1 (Myc-DDK-tagged)-Human dynein, light chain, Tctex-type 1 (DYNLT1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$225.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DYNLT1
Synonyms CW-1; TCTEL1; tctex-1; TCTEX1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC218331 representing NM_006519
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAGACTACCAGGCTGCGGAGGAGACTGCTTTTGTTGTTGATGAAGTGAGCAACATTGTAAAAGAGG
CTATAGAAAGCGCAATTGGTGGTAACGCTTATCAACACAGCAAAGTGAACCAGTGGACCACAAATGTAGT
AGAACAAACTTTAAGCCAACTCACCAAGCTGGGAAAACCATTTAAATACATCGTGACCTGTGTAATTATG
CAGAAGAATGGAGCTGGATTACACACAGCAAGTTCCTGCTTCTGGGACAGCTCTACTGACGGGAGCTGCA
CTGTGCGATGGGAGAATAAGACCATGTACTGCATCGTCAGTGCCTTCGGACTGTCTATT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC218331 representing NM_006519
Red=Cloning site Green=Tags(s)

MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIM
QKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006519
ORF Size 339 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006519.4
RefSeq Size 713 bp
RefSeq ORF 342 bp
Locus ID 6993
UniProt ID P63172
Cytogenetics 6q25.3
Domains Tctex-1
MW 12.3 kDa
Summary This gene encodes a component of the motor complex, cytoplasmic dynein, which transports cellular cargo along microtubules in the cell. The encoded protein regulates the length of primary cilia which are sensory organelles found on the surface of cells. The protein encoded by this gene interacts with viral proteins, like the minor capsid protein L2 of human papillomavirus, and is required for dynein-mediated delivery of the viral nucleic acid to the host nucleus. This protein interacts with oncogenic nucleoporins to disrupt gene regulation and cause leukemic transformation. Pseudogenes of this gene are present on chromosomes 4 and 17. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2014]
Write Your Own Review
You're reviewing:DYNLT1 (NM_006519) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC218331L1 Lenti ORF clone of Human dynein, light chain, Tctex-type 1 (DYNLT1), Myc-DDK-tagged 10 ug
$525.00
RC218331L2 Lenti ORF clone of Human dynein, light chain, Tctex-type 1 (DYNLT1), mGFP tagged 10 ug
$525.00
RC218331L3 Lenti ORF clone of Human dynein, light chain, Tctex-type 1 (DYNLT1), Myc-DDK-tagged 10 ug
$525.00
RC218331L4 Lenti ORF clone of Human dynein, light chain, Tctex-type 1 (DYNLT1), mGFP tagged 10 ug
$525.00
RG218331 DYNLT1 (tGFP-tagged) - Human dynein, light chain, Tctex-type 1 (DYNLT1) 10 ug
$425.00
SC126752 DYNLT1 (untagged)-Human dynein, light chain, Tctex-type 1 (DYNLT1) 10 ug
$225.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.