OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SCARB1 (NM_001082959) Human Mass Spec Standard

Be the first to review this product
SKU
PH318270
SCARB1 MS Standard C13 and N15-labeled recombinant protein (NP_001076428)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA507135 SCARB1 mouse monoclonal antibody, clone OTI1F3 (formerly 1F3) 100 ul
$447.00
LY401684 Transient overexpression lysate of scavenger receptor class B, member 1 (SCARB1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "SCARB1 or NM_001082959"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218270
Predicted MW 56 kDa
Protein Sequence
Protein Sequence
>RC218270 representing NM_001082959
Red=Cloning site Green=Tags(s)

MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFF
DVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNIL
VLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRAVGEIMWGYKDPLVNLINKYFPGMFPFKDKFGLFAE
LNNSDSGLFTVFTGVQNISRIHLVDKWNGLSKVDFWHSDQCNMINGTSGQMWPPFMTPESSLEFYSPEAC
RSMKLMYKESGVFEGIPTYRFVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNA
DPVLAEAVTGLHPNQEAHSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESG
AMEGETLHTFYTQLVLMPKVMHYAQYVLLALGCVLLLVPVICQIRSQGPEDTVSQPGLAAGPDRPPSPYT
PLLPDSPSGQPPSPTA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001076428
RefSeq Size 2630
RefSeq ORF 1518
Synonyms CD36L1; CLA-1; CLA1; HDLQTL6; SR-BI; SRB1
Locus ID 949
UniProt ID Q8WTV0
Cytogenetics 12q24.31
Summary The protein encoded by this gene is a plasma membrane receptor for high density lipoprotein cholesterol (HDL). The encoded protein mediates cholesterol transfer to and from HDL. In addition, this protein is a receptor for hepatitis C virus glycoprotein E2. Several transcript variants encoding different isoforms have been found for this gene.provided by RefSeq, Jan 2019
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SCARB1" proteins (7)
SKU Description Size Price
PH310264 SCARB1 MS Standard C13 and N15-labeled recombinant protein (NP_005496) 10 ug
$3,360.00
LC401684 Lyophilized SCARB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421197 Lyophilized SCARB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401684 Transient overexpression lysate of scavenger receptor class B, member 1 (SCARB1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY421197 Transient overexpression lysate of scavenger receptor class B, member 1 (SCARB1), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP310264 Recombinant protein of human scavenger receptor class B, member 1 (SCARB1), transcript variant 1, 20 µg 20 ug
$867.00
TP318270 Recombinant protein of human scavenger receptor class B, member 1 (SCARB1), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products