SCARB1 (NM_005505) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC210264] |
Predicted MW | 56.8 kDa |
Protein Sequence |
Protein Sequence
>RC210264 representing NM_005505
Red=Cloning site Green=Tags(s) MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFF DVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNIL VLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIMWGYKDPLVNLINKYFPGMFPFKDKFGLFAE LNNSDSGLFTVFTGVQNISRIHLVDKWNGLSKVDFWHSDQCNMINGTSGQMWPPFMTPESSLEFYSPEAC RSMKLMYKESGVFEGIPTYRFVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNA DPVLAEAVTGLHPNQEAHSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESG AMEGETLHTFYTQLVLMPKVMHYAQYVLLALGCVLLLVPVICQIRSQEKCYLFWSSSKKGSKDKEAIQAY SESLMTSAPKGSVLQEAKL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_005496 |
RefSeq Size | 2759 |
RefSeq ORF | 1527 |
Synonyms | CD36L1; CLA-1; CLA1; HDLQTL6; SR-BI; SRB1 |
Locus ID | 949 |
UniProt ID | Q8WTV0 |
Cytogenetics | 12q24.31 |
Summary | The protein encoded by this gene is a plasma membrane receptor for high density lipoprotein cholesterol (HDL). The encoded protein mediates cholesterol transfer to and from HDL. In addition, this protein is a receptor for hepatitis C virus glycoprotein E2. Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jan 2019] |
Protein Families | Druggable Genome, Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH318270 | SCARB1 MS Standard C13 and N15-labeled recombinant protein (NP_001076428) | 10 ug |
$3,255.00
|
|
LC401684 | SCARB1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC421197 | SCARB1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC425949 | SCARB1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY401684 | Transient overexpression lysate of scavenger receptor class B, member 1 (SCARB1), transcript variant 1 | 100 ug |
$436.00
|
|
LY421197 | Transient overexpression lysate of scavenger receptor class B, member 1 (SCARB1), transcript variant 2 | 100 ug |
$665.00
|
|
TP310264 | Recombinant protein of human scavenger receptor class B, member 1 (SCARB1), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP318270 | Recombinant protein of human scavenger receptor class B, member 1 (SCARB1), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.