SCARB1 (NM_005505) Human Mass Spec Standard

SKU
PH310264
SCARB1 MS Standard C13 and N15-labeled recombinant protein (NP_005496)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210264]
Predicted MW 56.8 kDa
Protein Sequence
Protein Sequence
>RC210264 representing NM_005505
Red=Cloning site Green=Tags(s)

MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFF
DVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNIL
VLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIMWGYKDPLVNLINKYFPGMFPFKDKFGLFAE
LNNSDSGLFTVFTGVQNISRIHLVDKWNGLSKVDFWHSDQCNMINGTSGQMWPPFMTPESSLEFYSPEAC
RSMKLMYKESGVFEGIPTYRFVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNA
DPVLAEAVTGLHPNQEAHSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESG
AMEGETLHTFYTQLVLMPKVMHYAQYVLLALGCVLLLVPVICQIRSQEKCYLFWSSSKKGSKDKEAIQAY
SESLMTSAPKGSVLQEAKL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005496
RefSeq Size 2759
RefSeq ORF 1527
Synonyms CD36L1; CLA-1; CLA1; HDLQTL6; SR-BI; SRB1
Locus ID 949
UniProt ID Q8WTV0
Cytogenetics 12q24.31
Summary The protein encoded by this gene is a plasma membrane receptor for high density lipoprotein cholesterol (HDL). The encoded protein mediates cholesterol transfer to and from HDL. In addition, this protein is a receptor for hepatitis C virus glycoprotein E2. Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jan 2019]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:SCARB1 (NM_005505) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH318270 SCARB1 MS Standard C13 and N15-labeled recombinant protein (NP_001076428) 10 ug
$3,255.00
LC401684 SCARB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421197 SCARB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC425949 SCARB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401684 Transient overexpression lysate of scavenger receptor class B, member 1 (SCARB1), transcript variant 1 100 ug
$436.00
LY421197 Transient overexpression lysate of scavenger receptor class B, member 1 (SCARB1), transcript variant 2 100 ug
$665.00
TP310264 Recombinant protein of human scavenger receptor class B, member 1 (SCARB1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP318270 Recombinant protein of human scavenger receptor class B, member 1 (SCARB1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.