SCARB1 (NM_001082959) Human Recombinant Protein

SKU
TP318270
Recombinant protein of human scavenger receptor class B, member 1 (SCARB1), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC218270 representing NM_001082959
Red=Cloning site Green=Tags(s)

MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFF
DVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNIL
VLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRAVGEIMWGYKDPLVNLINKYFPGMFPFKDKFGLFAE
LNNSDSGLFTVFTGVQNISRIHLVDKWNGLSKVDFWHSDQCNMINGTSGQMWPPFMTPESSLEFYSPEAC
RSMKLMYKESGVFEGIPTYRFVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNA
DPVLAEAVTGLHPNQEAHSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESG
AMEGETLHTFYTQLVLMPKVMHYAQYVLLALGCVLLLVPVICQIRSQGPEDTVSQPGLAAGPDRPPSPYT
PLLPDSPSGQPPSPTA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 56 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001076428
Locus ID 949
UniProt ID Q8WTV0
Cytogenetics 12q24.31
RefSeq Size 2630
RefSeq ORF 1518
Synonyms CD36L1; CLA-1; CLA1; HDLQTL6; SR-BI; SRB1
Summary The protein encoded by this gene is a plasma membrane receptor for high density lipoprotein cholesterol (HDL). The encoded protein mediates cholesterol transfer to and from HDL. In addition, this protein is a receptor for hepatitis C virus glycoprotein E2. Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jan 2019]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:SCARB1 (NM_001082959) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH310264 SCARB1 MS Standard C13 and N15-labeled recombinant protein (NP_005496) 10 ug
$3,255.00
PH318270 SCARB1 MS Standard C13 and N15-labeled recombinant protein (NP_001076428) 10 ug
$3,255.00
LC401684 SCARB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421197 SCARB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC425949 SCARB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401684 Transient overexpression lysate of scavenger receptor class B, member 1 (SCARB1), transcript variant 1 100 ug
$436.00
LY421197 Transient overexpression lysate of scavenger receptor class B, member 1 (SCARB1), transcript variant 2 100 ug
$665.00
TP310264 Recombinant protein of human scavenger receptor class B, member 1 (SCARB1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.