OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

XRCC4 (NM_022550) Human Mass Spec Standard

Be the first to review this product
SKU
PH318029
XRCC4 MS Standard C13 and N15-labeled recombinant protein (NP_072044)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA500650 Anti-XRCC4 mouse monoclonal antibody, clone OTI4H9 (formerly 4H9) 100 ul
$447.00
LY402930 Transient overexpression lysate of X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "XRCC4 or NM_022550"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218029
Predicted MW 37.9 kDa
Protein Sequence
Protein Sequence
>RC218029 representing NM_022550
Red=Cloning site Green=Tags(s)

MERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEADDMAMEKGKYVGEL
RKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVENPAEVIRELICYCLDTIAENQAK
NEHLQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRSLHNKLLNAAQEREKDIK
QEGETAICSEMTADRDPVYDESTDEESENQTDLSGLASAAVSKDDSIISSLDVTDIAPSRKRRQRMQRNL
GTEPKMAPQENQLQEKENSRPDSSLPETSKKEHISAENMSLETLRNSSPEDLFDEI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_072044
RefSeq Size 1707
RefSeq ORF 1008
Synonyms SSMED
Locus ID 7518
UniProt ID Q13426
Cytogenetics 5q14.2
Summary The protein encoded by this gene functions together with DNA ligase IV and the DNA-dependent protein kinase in the repair of DNA double-strand breaks. This protein plays a role in both non-homologous end joining and the completion of V(D)J recombination. Mutations in this gene can cause short stature, microcephaly, and endocrine dysfunction (SSMED). Alternate transcript variants such as NM_022406 are unlikely to be expressed in some individuals due to a polymorphism (rs1805377) in the last splice acceptor site. provided by RefSeq, Oct 2019
Protein Families Druggable Genome
Protein Pathways Non-homologous end-joining
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "XRCC4" proteins (7)
SKU Description Size Price
PH312684 XRCC4 MS Standard C13 and N15-labeled recombinant protein (NP_003392) 10 ug
$3,360.00
LC402930 Lyophilized XRCC4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418718 Lyophilized XRCC4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402930 Transient overexpression lysate of X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY418718 Transient overexpression lysate of X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP312684 Recombinant protein of human X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 1, 20 µg 20 ug
$867.00
TP318029 Recombinant protein of human X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

Quantification of XRCC and DNA-PK proteins in cancer cell lines and human tumors by LC-MS/MS
Myers, Maxwell, Wang
Bioanalysis (2014)
Cited by 2
AI Summary: OriGene contributed unlabeled and heavy isotope-labeled XRCC4 proteins, which were used as internal standards for quantifying XRCC and DNA-PK protein levels in cancer cell lines and tumor tissues by LC-MS/MS in this study.
Snippet: Materials &reagents The unlabeled and heavy isotope-labeled XRCC4 proteins were purchased from Origene (MD, USA). ... Origene reports the purity >80% as determined by SDS-PAGE and Coomassie blue staining and the labeling efficiency >90%. ... Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products