XRCC4 (NM_003401) Human Mass Spec Standard

SKU
PH312684
XRCC4 MS Standard C13 and N15-labeled recombinant protein (NP_003392)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212684]
Predicted MW 38.3 kDa
Protein Sequence
Protein Sequence
>RC212684 protein sequence
Red=Cloning site Green=Tags(s)

MERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEADDMAMEKGKYVGEL
RKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVENPAEVIRELICYCLDTIAENQAK
NEHLQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRSLHNKLLNAAQEREKDIK
QEGETAICSEMTADRDPVYDESTDEESENQTDLSGLASAAVSKDDSIISSLDVTDIAPSRKRRQRMQRNL
GTEPKMAPQENQLQEKENSRPDSSLPETSKKEHISAENMSLETLRNSSPEDLFDEI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003392
RefSeq Size 1688
RefSeq ORF 1008
Synonyms SSMED
Locus ID 7518
UniProt ID Q13426
Cytogenetics 5q14.2
Summary The protein encoded by this gene functions together with DNA ligase IV and the DNA-dependent protein kinase in the repair of DNA double-strand breaks. This protein plays a role in both non-homologous end joining and the completion of V(D)J recombination. Mutations in this gene can cause short stature, microcephaly, and endocrine dysfunction (SSMED). Alternate transcript variants such as NM_022406 are unlikely to be expressed in some individuals due to a polymorphism (rs1805377) in the last splice acceptor site. [provided by RefSeq, Oct 2019]
Protein Families Druggable Genome
Protein Pathways Non-homologous end-joining
Write Your Own Review
You're reviewing:XRCC4 (NM_003401) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH318029 XRCC4 MS Standard C13 and N15-labeled recombinant protein (NP_072044) 10 ug
$3,255.00
LC402930 XRCC4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC418718 XRCC4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402930 Transient overexpression lysate of X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 3 100 ug
$436.00
LY418718 Transient overexpression lysate of X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 1 100 ug
$436.00
TP312684 Recombinant protein of human X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP318029 Recombinant protein of human X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.