XRCC4 (NM_022550) Human Tagged ORF Clone

SKU
RC218029
XRCC4 (Myc-DDK-tagged)-Human X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 3
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol XRCC4
Synonyms SSMED
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC218029 representing NM_022550
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGAGAAAAATAAGCAGAATCCACCTTGTTTCTGAACCCAGTATAACTCATTTTCTACAAGTATCTT
GGGAGAAAACACTGGAATCTGGTTTTGTTATTACACTTACTGATGGTCATTCAGCATGGACTGGGACAGT
TTCTGAATCAGAGATTTCCCAAGAAGCTGATGACATGGCAATGGAAAAAGGGAAATATGTTGGTGAACTG
AGAAAAGCATTGTTGTCAGGAGCAGGACCAGCTGATGTATACACGTTTAATTTTTCTAAAGAGTCTTGTT
ATTTCTTCTTTGAGAAAAACCTGAAAGATGTCTCATTCAGACTTGGTTCCTTCAACCTAGAGAAAGTTGA
AAACCCAGCTGAAGTCATTAGAGAACTTATTTGTTATTGCTTGGACACCATTGCAGAAAATCAAGCCAAA
AATGAGCACCTGCAGAAAGAAAATGAAAGGCTTCTGAGAGATTGGAATGATGTTCAAGGACGATTTGAAA
AATGTGTGAGTGCTAAGGAAGCTTTGGAGACTGATCTTTATAAGCGGTTTATTCTGGTGTTGAATGAGAA
GAAAACAAAAATCAGAAGTTTGCATAATAAATTATTAAATGCAGCTCAAGAACGAGAAAAGGACATCAAA
CAAGAAGGGGAAACTGCAATCTGTTCTGAAATGACTGCTGACCGAGATCCAGTCTATGATGAGAGTACTG
ATGAGGAAAGTGAAAACCAAACTGATCTCTCTGGGTTGGCTTCAGCTGCTGTAAGTAAAGATGATTCCAT
TATTTCAAGTCTTGATGTCACTGATATTGCACCAAGTAGAAAAAGGAGACAGCGAATGCAAAGAAATCTT
GGGACAGAACCTAAAATGGCTCCTCAGGAGAATCAGCTTCAAGAAAAGGAAAATTCTAGGCCTGATTCTT
CACTACCTGAGACGTCTAAAAAGGAGCACATCTCAGCTGAAAACATGTCTTTAGAAACTCTGAGAAACAG
CAGCCCAGAAGACCTCTTTGATGAGATT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC218029 representing NM_022550
Red=Cloning site Green=Tags(s)

MERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEADDMAMEKGKYVGEL
RKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVENPAEVIRELICYCLDTIAENQAK
NEHLQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRSLHNKLLNAAQEREKDIK
QEGETAICSEMTADRDPVYDESTDEESENQTDLSGLASAAVSKDDSIISSLDVTDIAPSRKRRQRMQRNL
GTEPKMAPQENQLQEKENSRPDSSLPETSKKEHISAENMSLETLRNSSPEDLFDEI

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_022550
ORF Size 1008 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_022550.3
RefSeq Size 1707 bp
RefSeq ORF 1005 bp
Locus ID 7518
UniProt ID Q13426
Cytogenetics 5q14.2
Protein Families Druggable Genome
Protein Pathways Non-homologous end-joining
MW 37.9 kDa
Summary The protein encoded by this gene functions together with DNA ligase IV and the DNA-dependent protein kinase in the repair of DNA double-strand breaks. This protein plays a role in both non-homologous end joining and the completion of V(D)J recombination. Mutations in this gene can cause short stature, microcephaly, and endocrine dysfunction (SSMED). Alternate transcript variants such as NM_022406 are unlikely to be expressed in some individuals due to a polymorphism (rs1805377) in the last splice acceptor site. [provided by RefSeq, Oct 2019]
Write Your Own Review
You're reviewing:XRCC4 (NM_022550) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC218029L1 Lenti ORF clone of Human X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 3, Myc-DDK-tagged 10 ug
$757.00
RC218029L2 Lenti ORF clone of Human X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 3, mGFP tagged 10 ug
$757.00
RC218029L3 Lenti ORF clone of Human X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 3, Myc-DDK-tagged 10 ug
$757.00
RC218029L4 Lenti ORF clone of Human X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 3, mGFP tagged 10 ug
$757.00
RG218029 XRCC4 (tGFP-tagged) - Human X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 3 10 ug
$489.00 MSRP $657.00 MSRP $657.00
SC126125 XRCC4 (untagged)-Human X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 3 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.