OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RBP2 (NM_004164) Human Mass Spec Standard

Be the first to review this product
SKU
PH317970
RBP2 MS Standard C13 and N15-labeled recombinant protein (NP_004155)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA380799 RBP2 Rabbit polyclonal Antibody
100 ul
$410.00
LY418171 Transient overexpression lysate of retinol binding protein 2, cellular (RBP2) (as WB positive control) 100 ug
$436.00

Other products for "RBP2 or NM_004164"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217970
Predicted MW 15.5 kDa
Protein Sequence
Protein Sequence
>RC217970 representing NM_004164
Red=Cloning site Green=Tags(s)

MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVE
FDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004155
RefSeq Size 700
RefSeq ORF 402
Synonyms CRABP-II; CRBP2; CRBPII; RBPC2
Locus ID 5948
UniProt ID P50120
Cytogenetics 3q23
Summary This gene encodes an abundant protein present in the small intestinal epithelium. It is thought to participate in the uptake and/or intracellular metabolism of vitamin A. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. This protein may also modulate the supply of retinoic acid to the nuclei of endometrial cells during the menstrual cycle. provided by RefSeq, Aug 2015
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RBP2" proteins (3)
SKU Description Size Price
LC418171 Lyophilized RBP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418171 Transient overexpression lysate of retinol binding protein 2, cellular (RBP2) (as WB positive control) 100 ug
$436.00
TP317970 Recombinant protein of human retinol binding protein 2, cellular (RBP2), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products