OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RBP2 (NM_004164) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC217970
RBP2 (Myc-DDK-tagged)-Human retinol binding protein 2, cellular (RBP2)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $150.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA380799 RBP2 Rabbit polyclonal Antibody
100 ul
$410.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "RBP2 or NM_004164"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RBP2
Synonyms CRABP-II; CRBP2; CRBPII; RBPC2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC217970 representing NM_004164
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACAAGGGACCAGAATGGAACCTGGGAGATGGAGAGTAATGAAAACTTTGAGGGCTACATGAAGGCCC
TGGATATTGATTTTGCCACCCGCAAGATTGCAGTACGTCTCACTCAGACGAAGGTTATTGATCAAGATGG
TGATAACTTCAAGACAAAAACCACTAGCACATTCCGCAACTATGATGTGGATTTCACTGTTGGAGTAGAG
TTTGACGAGTACACAAAGAGCCTGGATAACCGGCATGTTAAGGCACTGGTCACCTGGGAAGGTGATGTCC
TTGTGTGTGTGCAAAAGGGGGAGAAGGAGAACCGCGGCTGGAAGCAGTGGATTGAGGGGGACAAGCTGTA
CCTGGAGCTGACCTGTGGTGACCAGGTGTGCCGTCAAGTGTTCAAAAAGAAA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC217970 representing NM_004164
Red=Cloning site Green=Tags(s)

MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVE
FDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_004164
ORF Size 402 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004164.3
RefSeq Size 700 bp
RefSeq ORF 405 bp
Locus ID 5948
UniProt ID P50120
Cytogenetics 3q23
MW 15.5 kDa
Summary This gene encodes an abundant protein present in the small intestinal epithelium. It is thought to participate in the uptake and/or intracellular metabolism of vitamin A. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. This protein may also modulate the supply of retinoic acid to the nuclei of endometrial cells during the menstrual cycle. provided by RefSeq, Aug 2015
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_004164" in other vectors (6)
SKU Description Size Price
RC217970L1 Lenti ORF clone of Human retinol binding protein 2, cellular (RBP2), Myc-DDK-tagged 10 ug
$450.00
RC217970L2 Lenti ORF clone of Human retinol binding protein 2, cellular (RBP2), mGFP tagged 10 ug
$450.00
RC217970L3 Lenti ORF clone of Human retinol binding protein 2, cellular (RBP2), Myc-DDK-tagged 10 ug
$450.00
RC217970L4 Lenti ORF clone of Human retinol binding protein 2, cellular (RBP2), mGFP tagged 10 ug
$450.00
RG217970 RBP2 (tGFP-tagged) - Human retinol binding protein 2, cellular (RBP2) 10 ug
$350.00
SC303445 RBP2 (untagged)-Human retinol binding protein 2, cellular (RBP2) 10 ug
$165.00

Plasmid Map for RC217970

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC217970
Circular map for RC217970

file-alt Citations

Molecular basis for the interaction of cellular retinol-binding protein 2 (CRBP2) with non-retinoid ligands
Silvaroli, Plau, Adams et al
J Lipid Res (2021) 62, 100054 DOI: 10.1016/j.jlr.2021.100054
Cited by 12
AI Summary: OriGene contributed to this study by providing the synthetic cDNA clone of human CRBP2 (NP_004155.2), which was used for protein expression and purification to investigate CRBP2's interactions with various lipid ligands.
Snippet: Materials and Methods. Expression and purification of CRBP2. Purification of human CRBP2 was performed essentially as described previously (9). The synthetic clone of cDNA (NP_004155.2, Origene Technologies) was inserted into pET3b vector (Novagen)
Abnormal Cannabidiol Modulates Vitamin A Metabolism by Acting as a Competitive Inhibitor of CRBP1
Silvaroli, Widjaja-Adhi, Trischman et al
ACS Chem. Biol. (2019)
AI Summary: OriGene’s human CRBP2 cDNA was used as a template to generate recombinant CRBP2 protein for functional and structural studies in this paper.
Snippet: The cDNA of human CRBP2 was purchased from Origene Technologies and amplified by polymerase chain reaction (PCR) using the following primers: forward −GCAGATCATATGACAAGGGACCAGAATGGAACC and reverse −CGTCTACTCGAGTCCCGGGGATCCACGCGGAACCAGTTTCTTTTTGAACACTTGACGG to subclone into pET30b expression vector (Millipore Sigma), thereby modifying the C-terminal sequence to introduce thrombin cut site that allowed for removal of a 6x histidine tag from the purified protein. …
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products