OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

USP2 (NM_171997) Human Mass Spec Standard

Be the first to review this product
SKU
PH317695
USP2 MS Standard C13 and N15-labeled recombinant protein (NP_741994)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349558 Rabbit Polyclonal Anti-USP2 Antibody
100 ul
$205.00
LY401351 Transient overexpression lysate of ubiquitin specific peptidase 2 (USP2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "USP2 or NM_171997"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217695
Predicted MW 45.1 kDa
Protein Sequence
Protein Sequence
>RC217695 representing NM_171997
Red=Cloning site Green=Tags(s)

MRTSYTVTLPEDPPAAPFPALAKELRPRSPLSPSLLLSTFVGLLLNKAKNSKSAQGLAGLRNLGNTCFMN
SILQCLSNTRELRDYCLQRLYMRDLHHGSNAHTALVEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPR
FVGYNQQDAQEFLRFLLDGLHNEVNRVTLRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGDLFVGQL
KSSLTCTDCGYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMRLFTKEDVLDGDEKPTCCRCRGRKRCIKKF
SIQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRDLDLREFASENTNHAVYNLYAVSNHSGTTMGGHYT
AYCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYELASPPSRM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_741994
RefSeq Size 1378
RefSeq ORF 1188
Synonyms UBP41; USP9
Locus ID 9099
UniProt ID O75604
Cytogenetics 11q23.3
Summary This gene encodes a member of the family of de-ubiquitinating enzymes, which belongs to the peptidase C19 superfamily. The encoded protein is a ubiquitin-specific protease which is required for TNF-alpha (tumor necrosis factor alpha) -induced NF-kB (nuclear factor kB) signaling. This protein deubiquitinates polyubiquitinated target proteins such as fatty acid synthase, murine double minute 2 (MDM2), MDM4/MDMX and cyclin D1. MDM2 and MDM4 are negative regulators of the p53 tumor suppressor and cyclin D1 is required for cell cycle G1/S transition. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. provided by RefSeq, Aug 2011
Protein Families Protease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "USP2" proteins (5)
SKU Description Size Price
LC401351 Lyophilized USP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC403527 Lyophilized USP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401351 Transient overexpression lysate of ubiquitin specific peptidase 2 (USP2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY403527 Transient overexpression lysate of ubiquitin specific peptidase 2 (USP2), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP317695 Recombinant protein of human ubiquitin specific peptidase 2 (USP2), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products