OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NCAPH2 (NM_014551) Human Mass Spec Standard

Be the first to review this product
SKU
PH317604
NCAPH2 MS Standard C13 and N15-labeled recombinant protein (NP_055366)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA329770 Rabbit polyclonal Anti-NCAPH2 Antibody
100 ul
$585.00
LY415228 Transient overexpression lysate of non-SMC condensin II complex, subunit H2 (NCAPH2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "NCAPH2 or NM_014551"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217604
Predicted MW 32.6 kDa
Protein Sequence
Protein Sequence
>RC217604 representing NM_014551
Red=Cloning site Green=Tags(s)

MEDVEARFAHLLQPIRDLTKNWEVDVAAQLGEYLEELDQICISFDEGKTTMNFIEAALLIQGSACVYSKK
VEYLYSLVYQALDFISGKRRAKQLSSVQEDRANGVASSGVPQEAENEFLSLDDFPDSRTNVDLKNDQTPS
EVLIIPLLPMALVAPDEMEKNNNPLYSRQGEVLASRKDFRMNTCVPHPRGAFMLEPEGMSPMEPAGVSPM
PGTQKDTGRTEEQPMEVSVCRSPVPALGFSQEPGPSPEGPMPLGGGEDEDAEEAVELPEASAPKAALEPK
ESRSPQQVGPTWRPAEPEL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055366
RefSeq Size 1440
RefSeq ORF 897
Synonyms CAPH2
Locus ID 29781
UniProt ID Q6IBW4
Cytogenetics 22q13.33
Summary This gene encodes one of the non-SMC subunits of the condensin II complex. This complex plays an essential role in mitotic chromosome assembly. Alternate splicing of this gene results in multiple transcript variants.provided by RefSeq, May 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NCAPH2" proteins (3)
SKU Description Size Price
LC415228 Lyophilized NCAPH2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415228 Transient overexpression lysate of non-SMC condensin II complex, subunit H2 (NCAPH2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP317604 Purified recombinant protein of Homo sapiens non-SMC condensin II complex, subunit H2 (NCAPH2), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products