NCAPH2 Rabbit Polyclonal Antibody

SKU TA329770

Rabbit polyclonal Anti-NCAPH2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NCAPH2 antibody: synthetic peptide directed towards the N terminal of human NCAPH2. Synthetic peptide located within the following region: EYLYSLVYQALDFISGKRRAKQLSSVQEDRANGVASSGVPQEAENEFLSL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 68 kDa
• Gene Name: non-SMC condensin II complex subunit H2
• Database Link:
  NP_055366
  Q6IBW4
• Background: Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 and SMC4, but they contain different sets of non-SMC subunits. NCAPH2 is 1 of 3 non-SMC subunits that define condensin II.Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 (MIM 605576) and SMC4 (MIM 605575), but they contain different sets of non-SMC subunits. NCAPH2 is 1 of 3 non-SMC subunits that define condensin II.
• Synonyms: CAPH2
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 86%

Reference Data