OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MID1IP1 (NM_001098790) Human Mass Spec Standard

Be the first to review this product
SKU
PH317566
MID1IP1 MS Standard C13 and N15-labeled recombinant protein (NP_001092260)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA309030 Rabbit Polyclonal antibody to MID1IP1 (MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)))
100 ul
$665.00
LY400445 Transient overexpression lysate of MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "MID1IP1 or NM_001098790"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217566
Predicted MW 20.2 kDa
Protein Sequence
Protein Sequence
>RC217566 protein sequence
Red=Cloning site Green=Tags(s)

MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPV
PDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGE
EDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001092260
RefSeq Size 2020
RefSeq ORF 549
Synonyms G12-like; MIG12; S14R; STRAIT11499; THRSPL
Locus ID 58526
UniProt ID Q9NPA3
Cytogenetics Xp11.4
Summary Plays a role in the regulation of lipogenesis in liver. Up-regulates ACACA enzyme activity. Required for efficient lipid biosynthesis, including triacylglycerol, diacylglycerol and phospholipid. Involved in stabilization of microtubules (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MID1IP1" proteins (11)
SKU Description Size Price
PH303444 MID1IP1 MS Standard C13 and N15-labeled recombinant protein (NP_067065) 10 ug
$3,360.00
PH321845 MID1IP1 MS Standard C13 and N15-labeled recombinant protein (NP_001092261) 10 ug
$3,360.00
LC400445 Lyophilized MID1IP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC411994 Lyophilized MID1IP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420677 Lyophilized MID1IP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400445 Transient overexpression lysate of MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY411994 Transient overexpression lysate of MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420677 Transient overexpression lysate of MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP303444 Recombinant protein of human MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 1, 20 µg 20 ug
$867.00
TP317566 Recombinant protein of human MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 2, 20 µg 20 ug
$867.00
TP321845 Recombinant protein of human MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products