MID1IP1 (NM_021242) Human Mass Spec Standard

SKU
PH303444
MID1IP1 MS Standard C13 and N15-labeled recombinant protein (NP_067065)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203444]
Predicted MW 20.2 kDa
Protein Sequence
Protein Sequence
>RC203444 protein sequence
Red=Cloning site Green=Tags(s)

MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPV
PDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGE
EDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_067065
RefSeq Size 3795
RefSeq ORF 549
Synonyms G12-like; MIG12; S14R; STRAIT11499; THRSPL
Locus ID 58526
UniProt ID Q9NPA3
Cytogenetics Xp11.4
Summary Plays a role in the regulation of lipogenesis in liver. Up-regulates ACACA enzyme activity. Required for efficient lipid biosynthesis, including triacylglycerol, diacylglycerol and phospholipid. Involved in stabilization of microtubules (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:MID1IP1 (NM_021242) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH317566 MID1IP1 MS Standard C13 and N15-labeled recombinant protein (NP_001092260) 10 ug
$3,255.00
PH321845 MID1IP1 MS Standard C13 and N15-labeled recombinant protein (NP_001092261) 10 ug
$3,255.00
LC400445 MID1IP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC411994 MID1IP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420677 MID1IP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429650 MID1IP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400445 Transient overexpression lysate of MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 3 100 ug
$436.00
LY411994 Transient overexpression lysate of MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 1 100 ug
$436.00
LY420677 Transient overexpression lysate of MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 2 100 ug
$436.00
TP303444 Recombinant protein of human MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP317566 Recombinant protein of human MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP321845 Recombinant protein of human MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.