MID1IP1 (NM_001098791) Human Recombinant Protein

SKU
TP321845
Recombinant protein of human MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC221845 protein sequence
Red=Cloning site Green=Tags(s)

MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPV
PDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGE
EDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 20 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001092261
Locus ID 58526
UniProt ID Q9NPA3
Cytogenetics Xp11.4
RefSeq Size 1916
RefSeq ORF 549
Synonyms G12-like; MIG12; S14R; STRAIT11499; THRSPL
Summary Plays a role in the regulation of lipogenesis in liver. Up-regulates ACACA enzyme activity. Required for efficient lipid biosynthesis, including triacylglycerol, diacylglycerol and phospholipid. Involved in stabilization of microtubules (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:MID1IP1 (NM_001098791) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303444 MID1IP1 MS Standard C13 and N15-labeled recombinant protein (NP_067065) 10 ug
$3,255.00
PH317566 MID1IP1 MS Standard C13 and N15-labeled recombinant protein (NP_001092260) 10 ug
$3,255.00
PH321845 MID1IP1 MS Standard C13 and N15-labeled recombinant protein (NP_001092261) 10 ug
$3,255.00
LC400445 MID1IP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC411994 MID1IP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420677 MID1IP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429650 MID1IP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400445 Transient overexpression lysate of MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 3 100 ug
$436.00
LY411994 Transient overexpression lysate of MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 1 100 ug
$436.00
LY420677 Transient overexpression lysate of MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 2 100 ug
$436.00
TP303444 Recombinant protein of human MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP317566 Recombinant protein of human MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.