OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PMPCA (NM_015160) Human Mass Spec Standard

Be the first to review this product
SKU
PH317017
PMPCA MS Standard C13 and N15-labeled recombinant protein (NP_055975)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA331965 Rabbit Polyclonal Anti-PMPCA Antibody
100 ul
$585.00
LY414752 Transient overexpression lysate of peptidase (mitochondrial processing) alpha (PMPCA), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$665.00

Other products for "PMPCA or NM_015160"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217017
Predicted MW 58.1 kDa
Protein Sequence
Protein Sequence
>RC217017 representing NM_015160
Red=Cloning site Green=Tags(s)

MAAVVLAATRLLRGSGSWGCSRLRFGPPAYRRFSSGGAYPNIPLSSPLPGVPKPVFATVDGQEKFETKVT
TLDNGLRVASQNKFGQFCTVGILINSGSRYEAKYLSGIAHFLEKLAFSSTARFDSKDEILLTLEKHGGIC
YCQTSRDTTMYAVSADSKGLDTVVALLADVVLQPRLTDEEVEMTRMAVQFELEDLNLRPDPEPLLTEMIH
EAAYRENTVGLHRFCPTENVAKINREVLHSYLRNYYTPDRMVLAGVGVEHEHLVDCARKYLLGVQPAWGS
AEAVDIDRSVAQYTGGIAKLERDMSNVSLGPTPIPELTHIMVGLESCSFLEEDFIPFAVLNMMMGGGGSF
SAGGPGKGMFSRLYLNVLNRHHWMYNATSYHHSYEDTGLLCIHASADPRQVREMVEIITKEFILMGGTVD
TVELERAKTQLTSMLMMNLESRPVIFEDVGRQVLATRSRKLPHELCTLIRNVKPEDVKRVASKMLRGKPA
VAALGDLTDLPTYEHIQTALSSKDGRLPRTYRLFR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055975
RefSeq Size 2097
RefSeq ORF 1575
Synonyms Alpha-MPP; CLA1; CPD3; INPP5E; MAS2; P-55; SCAR2
Locus ID 23203
UniProt ID Q10713
Cytogenetics 9q34.3
Summary The protein encoded by this gene is found in the mitochondrion, where it represents the alpha subunit of a proteolytic heterodimer. This heterodimer is responsible for cleaving the transit peptide from nuclear-encoded mitochondrial proteins. Defects in this gene are a cause of spinocerebellar ataxia, autosomal recessive 2. provided by RefSeq, Mar 2016
Protein Families Druggable Genome, Protease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PMPCA" proteins (3)
SKU Description Size Price
LC414752 Lyophilized PMPCA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414752 Transient overexpression lysate of peptidase (mitochondrial processing) alpha (PMPCA), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$665.00
TP317017 Recombinant protein of human peptidase (mitochondrial processing) alpha (PMPCA), nuclear gene encoding mitochondrial protein, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products