OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PMPCA (NM_015160) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP317017
Recombinant protein of human peptidase (mitochondrial processing) alpha (PMPCA), nuclear gene encoding mitochondrial protein, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA331965 Rabbit Polyclonal Anti-PMPCA Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "PMPCA or NM_015160"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC217017 representing NM_015160
Red=Cloning site Green=Tags(s)

MAAVVLAATRLLRGSGSWGCSRLRFGPPAYRRFSSGGAYPNIPLSSPLPGVPKPVFATVDGQEKFETKVT
TLDNGLRVASQNKFGQFCTVGILINSGSRYEAKYLSGIAHFLEKLAFSSTARFDSKDEILLTLEKHGGIC
YCQTSRDTTMYAVSADSKGLDTVVALLADVVLQPRLTDEEVEMTRMAVQFELEDLNLRPDPEPLLTEMIH
EAAYRENTVGLHRFCPTENVAKINREVLHSYLRNYYTPDRMVLAGVGVEHEHLVDCARKYLLGVQPAWGS
AEAVDIDRSVAQYTGGIAKLERDMSNVSLGPTPIPELTHIMVGLESCSFLEEDFIPFAVLNMMMGGGGSF
SAGGPGKGMFSRLYLNVLNRHHWMYNATSYHHSYEDTGLLCIHASADPRQVREMVEIITKEFILMGGTVD
TVELERAKTQLTSMLMMNLESRPVIFEDVGRQVLATRSRKLPHELCTLIRNVKPEDVKRVASKMLRGKPA
VAALGDLTDLPTYEHIQTALSSKDGRLPRTYRLFR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 58.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_055975
Locus ID 23203
UniProt ID Q10713
Cytogenetics 9q34.3
RefSeq Size 2097
RefSeq ORF 1575
Synonyms Alpha-MPP; CLA1; CPD3; INPP5E; MAS2; P-55; SCAR2
Summary The protein encoded by this gene is found in the mitochondrion, where it represents the alpha subunit of a proteolytic heterodimer. This heterodimer is responsible for cleaving the transit peptide from nuclear-encoded mitochondrial proteins. Defects in this gene are a cause of spinocerebellar ataxia, autosomal recessive 2. provided by RefSeq, Mar 2016
Protein Categories Enzyme: Peptidases, Intracellular Proteins, Nervous system: Neurodegenerative diseases
Protein Families Druggable Genome, Protease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PMPCA" proteins (3)
SKU Description Size Price
PH317017 PMPCA MS Standard C13 and N15-labeled recombinant protein (NP_055975) 10 ug
$3,360.00
LC414752 Lyophilized PMPCA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414752 Transient overexpression lysate of peptidase (mitochondrial processing) alpha (PMPCA), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$665.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products