OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

APRT (NM_000485) Human Mass Spec Standard

Be the first to review this product
SKU
PH316874
APRT MS Standard C13 and N15-labeled recombinant protein (NP_000476)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA324753 APRT Antibody (N-term)
400 ul
$645.00
LY424695 Transient overexpression lysate of adenine phosphoribosyltransferase (APRT), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "APRT or NM_000485"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC216874
Predicted MW 19.6 kDa
Protein Sequence
Protein Sequence
>RC216874 protein sequence
Red=Cloning site Green=Tags(s)

MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFL
FGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAAC
ELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000476
RefSeq Size 807
RefSeq ORF 540
Synonyms AMP; APRTD
Locus ID 353
UniProt ID P07741
Cytogenetics 16q24.3
Summary Adenine phosphoribosyltransferase belongs to the purine/pyrimidine phosphoribosyltransferase family. A conserved feature of this gene is the distribution of CpG dinucleotides. This enzyme catalyzes the formation of AMP and inorganic pyrophosphate from adenine and 5-phosphoribosyl-1-pyrophosphate (PRPP). It also produces adenine as a by-product of the polyamine biosynthesis pathway. A homozygous deficiency in this enzyme causes 2,8-dihydroxyadenine urolithiasis. Two transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Purine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "APRT" proteins (5)
SKU Description Size Price
LC422236 Lyophilized APRT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424695 Lyophilized APRT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY422236 Transient overexpression lysate of adenine phosphoribosyltransferase (APRT), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY424695 Transient overexpression lysate of adenine phosphoribosyltransferase (APRT), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP316874 Recombinant protein of human adenine phosphoribosyltransferase (APRT), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products