TTPAL (NM_001039199) Human Mass Spec Standard

CAT#: PH316730

TTPAL MS Standard C13 and N15-labeled recombinant protein (NP_001034288)

Product Images

Coomassie blue staining of purified TTPAL protein (Cat# TP316730). The protein was produced from HEK293T cells transfected with TTPAL cDNA clone (Cat# RC216730) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC216730
• Predicted MW: 38.5 kDa
• Protein Sequence:
  Sequence Link

  >RC216730 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSEESDSLRTSPSVASLSENELPPPPEPPGYVCSLTEDLVTKAREELQEKPEWRLRDVQALRDMVRKEYP
  NLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHSCRRSWPEVFNNLKPSALKDVLASGFLTVLPHTDPRG
  CHVVCIRPDRWIPSNYPITENIRAIYLTLEKLIQSEETQVNGIVILADYKGVSLSKASHFGPFIAKKVIG
  ILQDGFPIRIKAVHVVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLNSLHTNLPRSILPKEYGGTAGE
  LDTATWNAVLLASEDDFVKEFCQPVPACDSILGQTLLPEGLTSDAQCDDSLRAVKSQLYSCY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001034288
• RefSeq Size: 6212
• RefSeq ORF: 1026
• Synonyms: C20orf121
• Locus ID: 79183
• UniProt ID: Q9BTX7, B2RA57
• Cytogenetics: 20q13.12
• Summary: May act as a protein that binds a hydrophobic ligand.[UniProtKB/Swiss-Prot Function]