OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TTPAL (NM_024331) Human Mass Spec Standard

Be the first to review this product
SKU
PH300776
TTPAL MS Standard C13 and N15-labeled recombinant protein (NP_077307)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY411290 Transient overexpression lysate of tocopherol (alpha) transfer protein-like (TTPAL), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "TTPAL or NM_024331"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200776
Predicted MW 38.5 kDa
Protein Sequence
Protein Sequence
>RC200776 protein sequence
Red=Cloning site Green=Tags(s)

MSEESDSLRTSPSVASLSENELPPPPEPPGYVCSLTEDLVTKAREELQEKPEWRLRDVQALRDMVRKEYP
NLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHSCRRSWPEVFNNLKPSALKDVLASGFLTVLPHTDPRG
CHVVCIRPDRWIPSNYPITENIRAIYLTLEKLIQSEETQVNGIVILADYKGVSLSKASHFGPFIAKKVIG
ILQDGFPIRIKAVHVVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLNSLHTNLPRSILPKEYGGTAGE
LDTATWNAVLLASEDDFVKEFCQPVPACDSILGQTLLPEGLTSDAQCDDSLRAVKSQLYSCY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_077307
RefSeq Size 6236
RefSeq ORF 1026
Synonyms C20orf121
Locus ID 79183
UniProt ID Q9BTX7
Cytogenetics 20q13.12
Summary May act as a protein that binds a hydrophobic ligand.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TTPAL" proteins (7)
SKU Description Size Price
PH316730 TTPAL MS Standard C13 and N15-labeled recombinant protein (NP_001034288) 10 ug
$3,360.00
LC411290 Lyophilized TTPAL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422027 Lyophilized TTPAL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411290 Transient overexpression lysate of tocopherol (alpha) transfer protein-like (TTPAL), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY422027 Transient overexpression lysate of tocopherol (alpha) transfer protein-like (TTPAL), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP300776 Recombinant protein of human tocopherol (alpha) transfer protein-like (TTPAL), transcript variant 1, 20 µg 20 ug
$867.00
TP316730 Recombinant protein of human tocopherol (alpha) transfer protein-like (TTPAL), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products