RASSF2 (NM_014737) Human Mass Spec Standard

CAT#: PH316299

RASSF2 MS Standard C13 and N15-labeled recombinant protein (NP_055552)

Product Images

Coomassie blue staining of purified RASSF2 protein (Cat# TP316299). The protein was produced from HEK293T cells transfected with RASSF2 cDNA clone (Cat# RC216299) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC216299
• Predicted MW: 37.6 kDa
• Protein Sequence:
  Sequence Link

  >RC216299 representing NM_014737
  Red=Cloning site Green=Tags(s)
  
  MDYSHQTSLVPCGQDKYISKNELLLHLKTYNLYYEGQNLQLRHREEEDEFIVEGLLNISWGLRRPIRLQM
  QDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQMPSSTDSRGLKPLQEDTPQL
  MRTRSDVGVRRRGNVRTPSDQRRIRRHRFSINGHFYNHKTSVFTPAYGSVTNVRINSTMTTPQVLKLLLN
  KFKIENSAEEFALYVVHTSGEKQKLKATDYPLIARILQGPCEQISKVFLMEKDQVEEVTYDVAQYIKFEM
  PVLKSFIQKLQEEEDREVKKLMRKYTVLRLMIRQRLEEIAETPATI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055552
• RefSeq Size: 5426
• RefSeq ORF: 978
• Synonyms: CENP-34; RASFADIN
• Locus ID: 9770
• UniProt ID: P50749
• Cytogenetics: 20p13
• Summary: This gene encodes a protein that contains a Ras association domain. Similar to its cattle and sheep counterparts, this gene is located near the prion gene. Two alternatively spliced transcripts encoding the same isoform have been reported. [provided by RefSeq, Jul 2008]