OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RASSF2 (NM_014737) Human Mass Spec Standard

Be the first to review this product
SKU
PH316299
RASSF2 MS Standard C13 and N15-labeled recombinant protein (NP_055552)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA308983 Rabbit Polyclonal antibody to RASSF2 (Ras association (RalGDS/AF-6) domain family member 2)
100 ul
$665.00
LY406875 Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "RASSF2 or NM_014737"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC216299
Predicted MW 37.6 kDa
Protein Sequence
Protein Sequence
>RC216299 representing NM_014737
Red=Cloning site Green=Tags(s)

MDYSHQTSLVPCGQDKYISKNELLLHLKTYNLYYEGQNLQLRHREEEDEFIVEGLLNISWGLRRPIRLQM
QDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQMPSSTDSRGLKPLQEDTPQL
MRTRSDVGVRRRGNVRTPSDQRRIRRHRFSINGHFYNHKTSVFTPAYGSVTNVRINSTMTTPQVLKLLLN
KFKIENSAEEFALYVVHTSGEKQKLKATDYPLIARILQGPCEQISKVFLMEKDQVEEVTYDVAQYIKFEM
PVLKSFIQKLQEEEDREVKKLMRKYTVLRLMIRQRLEEIAETPATI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055552
RefSeq Size 5426
RefSeq ORF 978
Synonyms CENP-34; RASFADIN
Locus ID 9770
UniProt ID P50749
Cytogenetics 20p13
Summary This gene encodes a protein that contains a Ras association domain. Similar to its cattle and sheep counterparts, this gene is located near the prion gene. Two alternatively spliced transcripts encoding the same isoform have been reported. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RASSF2" proteins (7)
SKU Description Size Price
PH317404 RASSF2 MS Standard C13 and N15-labeled recombinant protein (NP_739580) 10 ug
$3,360.00
LC406875 Lyophilized RASSF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC415073 Lyophilized RASSF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406875 Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY415073 Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP316299 Recombinant protein of human Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 1, 20 µg 20 ug
$867.00
TP317404 Recombinant protein of human Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products