RASSF2 (NM_170774) Human Recombinant Protein
SKU
TP317404
Recombinant protein of human Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 2, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC217404 protein sequence
Red=Cloning site Green=Tags(s) MDYSHQTSLVPCGQDKYISKNELLLHLKTYNLYYEGQNLQLRHREEEDEFIVEGLLNISWGLRRPIRLQM QDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQMPSSTDSRGLKPLQEDTPQL MRTRSDVGVRRRGNVRTPSDQRRIRRHRFSINGHFYNHKTSVFTPAYGSVTNVRINSTMTTPQVLKLLLN KFKIENSAEEFALYVVHTSGEKQKLKATDYPLIARILQGPCEQISKVFLMEKDQVEEVTYDVAQYIKFEM PVLKSFIQKLQEEEDREVKKLMRKYTVLRLMIRQRLEEIAETPATI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_739580 |
Locus ID | 9770 |
UniProt ID | P50749 |
Cytogenetics | 20p13 |
RefSeq Size | 5307 |
RefSeq ORF | 978 |
Synonyms | CENP-34; RASFADIN |
Summary | This gene encodes a protein that contains a Ras association domain. Similar to its cattle and sheep counterparts, this gene is located near the prion gene. Two alternatively spliced transcripts encoding the same isoform have been reported. [provided by RefSeq, Jul 2008] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH316299 | RASSF2 MS Standard C13 and N15-labeled recombinant protein (NP_055552) | 10 ug |
$3,255.00
|
|
PH317404 | RASSF2 MS Standard C13 and N15-labeled recombinant protein (NP_739580) | 10 ug |
$3,255.00
|
|
LC406875 | RASSF2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC415073 | RASSF2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC429435 | RASSF2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY406875 | Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 2 | 100 ug |
$436.00
|
|
LY415073 | Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 1 | 100 ug |
$436.00
|
|
TP316299 | Recombinant protein of human Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.