RASSF2 (NM_170774) Human Mass Spec Standard

SKU
PH317404
RASSF2 MS Standard C13 and N15-labeled recombinant protein (NP_739580)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217404]
Predicted MW 37.8 kDa
Protein Sequence
Protein Sequence
>RC217404 protein sequence
Red=Cloning site Green=Tags(s)

MDYSHQTSLVPCGQDKYISKNELLLHLKTYNLYYEGQNLQLRHREEEDEFIVEGLLNISWGLRRPIRLQM
QDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQMPSSTDSRGLKPLQEDTPQL
MRTRSDVGVRRRGNVRTPSDQRRIRRHRFSINGHFYNHKTSVFTPAYGSVTNVRINSTMTTPQVLKLLLN
KFKIENSAEEFALYVVHTSGEKQKLKATDYPLIARILQGPCEQISKVFLMEKDQVEEVTYDVAQYIKFEM
PVLKSFIQKLQEEEDREVKKLMRKYTVLRLMIRQRLEEIAETPATI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_739580
RefSeq Size 5307
RefSeq ORF 978
Synonyms CENP-34; RASFADIN
Locus ID 9770
UniProt ID P50749
Cytogenetics 20p13
Summary This gene encodes a protein that contains a Ras association domain. Similar to its cattle and sheep counterparts, this gene is located near the prion gene. Two alternatively spliced transcripts encoding the same isoform have been reported. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:RASSF2 (NM_170774) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH316299 RASSF2 MS Standard C13 and N15-labeled recombinant protein (NP_055552) 10 ug
$3,255.00
LC406875 RASSF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC415073 RASSF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429435 RASSF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406875 Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 2 100 ug
$436.00
LY415073 Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 1 100 ug
$436.00
TP316299 Recombinant protein of human Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP317404 Recombinant protein of human Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.