OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PTPN7 (NM_080588) Human Mass Spec Standard

Be the first to review this product
SKU
PH316254
PTPN7 MS Standard C13 and N15-labeled recombinant protein (NP_542155)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA503714 PTPN7 (HePTP) mouse monoclonal antibody, clone OTI3B10 (formerly 3B10) 100 ul
$447.00
LY409137 Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 7 (PTPN7), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "PTPN7 or NM_080588"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC216254
Predicted MW 45 kDa
Protein Sequence
Protein Sequence
>RC216254 protein sequence
Red=Cloning site Green=Tags(s)

MGASFWPIRQAREQQRRALSFRQTSWLSEPPLGPAPHLSMVQAHGGRSRAQPLTLSLGAAMTQPPPEKTP
AKKHVRLQERRGSNVALMLDVRSLGAVEPICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEF
LKIPSNFVSPEDLDIPGHASKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGP
MPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQYQ
EERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGCFIATRIGCQQL
KARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_542155
RefSeq Size 3265
RefSeq ORF 1197
Synonyms BPTP-4; HEPTP; LC-PTP; LPTP; PTPNI
Locus ID 5778
UniProt ID P35236
Cytogenetics 1q32.1
Summary The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This gene is preferentially expressed in a variety of hematopoietic cells, and is an early response gene in lymphokine stimulated cells. The non-catalytic N-terminus of this PTP can interact with MAP kinases and suppress the MAP kinase activities. This PTP was shown to be involved in the regulation of T cell antigen receptor (TCR) signaling, which was thought to function through dephosphorylating the molecules related to MAP kinase pathway. Multiple alternatively spliced transcript variants have been found for this gene. provided by RefSeq, Dec 2010
Protein Families Druggable Genome, Phosphatase
Protein Pathways MAPK signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PTPN7" proteins (5)
SKU Description Size Price
PH300699 PTPN7 MS Standard C13 and N15-labeled recombinant protein (NP_002823) 10 ug
$3,360.00
LC409137 Lyophilized PTPN7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409137 Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 7 (PTPN7), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP300699 Recombinant protein of human protein tyrosine phosphatase, non-receptor type 7 (PTPN7), transcript variant 1, 20 µg 20 ug
$867.00
TP316254 Recombinant protein of human protein tyrosine phosphatase, non-receptor type 7 (PTPN7), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products