OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DNAJC9 (NM_015190) Human Mass Spec Standard

Be the first to review this product
SKU
PH315630
DNAJC9 MS Standard C13 and N15-labeled recombinant protein (NP_056005)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA368195 DNAJC9 rabbit polyclonal antibody
100 ul
$310.00
LY414688 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 9 (DNAJC9) (as WB positive control) 100 ug
$436.00

Other products for "DNAJC9 or NM_015190"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC215630
Predicted MW 30.4 kDa
Protein Sequence
Protein Sequence
>RC215630 representing NM_015190
Red=Cloning site Green=Tags(s)

MGLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQILGKVYSVLS
DREQRAVYDEQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGD
MDQIMESVLCVQYTEEPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLD
EGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKSSKGGGKKSALKKEKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056005
RefSeq Size 1450
RefSeq ORF 780
Synonyms HDJC9; JDD1; SB73
Locus ID 23234
UniProt ID Q8WXX5
Cytogenetics 10q22.2
Summary May play a role as co-chaperone of the Hsp70 family proteins HSPA1A, HSPA1B and HSPA8.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DNAJC9" proteins (3)
SKU Description Size Price
LC414688 Lyophilized DNAJC9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414688 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 9 (DNAJC9) (as WB positive control) 100 ug
$436.00
TP315630 Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 9 (DNAJC9), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products