DNAJC9 (NM_015190) Human Mass Spec Standard

CAT#: PH315630

DNAJC9 MS Standard C13 and N15-labeled recombinant protein (NP_056005)

Product Images

Coomassie blue staining of purified DNAJC9 protein (Cat# TP315630). The protein was produced from HEK293T cells transfected with DNAJC9 cDNA clone (Cat# RC215630) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215630
• Predicted MW: 30.4 kDa
• Protein Sequence:
  Sequence Link

  >RC215630 representing NM_015190
  Red=Cloning site Green=Tags(s)
  
  MGLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQILGKVYSVLS
  DREQRAVYDEQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGD
  MDQIMESVLCVQYTEEPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLD
  EGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKSSKGGGKKSALKKEKK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056005
• RefSeq Size: 1450
• RefSeq ORF: 780
• Synonyms: HDJC9; JDD1; SB73
• Locus ID: 23234
• UniProt ID: Q8WXX5, A0A024QZN2
• Cytogenetics: 10q22.2
• Summary: May play a role as co-chaperone of the Hsp70 family proteins HSPA1A, HSPA1B and HSPA8.[UniProtKB/Swiss-Prot Function]