OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DNAJC9 (NM_015190) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP315630
Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 9 (DNAJC9), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA368195 DNAJC9 rabbit polyclonal antibody
100 ul
$310.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "DNAJC9 or NM_015190"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC215630 representing NM_015190
Red=Cloning site Green=Tags(s)

MGLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQILGKVYSVLS
DREQRAVYDEQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGD
MDQIMESVLCVQYTEEPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLD
EGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKSSKGGGKKSALKKEKK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 29.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_056005
Locus ID 23234
UniProt ID Q8WXX5
Cytogenetics 10q22.2
RefSeq Size 1450
RefSeq ORF 780
Synonyms HDJC9; JDD1; SB73
Summary May play a role as co-chaperone of the Hsp70 family proteins HSPA1A, HSPA1B and HSPA8.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DNAJC9" proteins (3)
SKU Description Size Price
PH315630 DNAJC9 MS Standard C13 and N15-labeled recombinant protein (NP_056005) 10 ug
$3,360.00
LC414688 Lyophilized DNAJC9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414688 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 9 (DNAJC9) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products