OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Protein Kinase D2 (PRKD2) (NM_016457) Human Mass Spec Standard

Be the first to review this product
SKU
PH315335
PRKD2 MS Standard C13 and N15-labeled recombinant protein (NP_057541)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501672 Anti-PRKD2 (Protein Kinase D2) mouse monoclonal antibody, clone OTI5G1 (formerly 5G1) 100 ul
$447.00
LY402555 Transient overexpression lysate of protein kinase D2 (PRKD2), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "Protein Kinase D2 or NM_016457"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC215335
Predicted MW 96.5 kDa
Protein Sequence
Protein Sequence
>RC215335 representing NM_016457
Red=Cloning site Green=Tags(s)

MATAPSYPAGLPGSPGPGSPPPPGGLELQSPPPLLPQIPAPGSGVSFHIQIGLTREFVLLPAASELAHVK
QLACSIVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSSGDIQEGDLVEVVLSASATFEDFQIRPHA
LTVHSYRAPAFCDHCGEMLFGLVRQGLKCDGCGLNYHKRCAFSIPNNCSGARKRRLSSTSLASGHSVRLG
TSESLPCTAEELSRSTTELLPRRPPSSSSSSSASSYTGRPIELDKMLLSKVKVPHTFLIHSYTRPTVCQA
CKKLLKGLFRQGLQCKDCKFNCHKRCATRVPNDCLGEALINGDVPMEEATDFSEADKSALMDESEDSGVI
PGSHSENALHASEEEEGEGGKAQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYWR
LDCKCITLFQNNTTNRYYKEIPLSEILTVESAQNFSLVPPGTNPHCFEIVTANATYFVGEMPGGTPGGPS
GQGAEAARGWETAIRQALMPVILQDAPSAPGHAPHRQASLSISVSNSQIQENVDIATVYQIFPDEVLGSG
QFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRNEVAILQSLRHPGIVNLECMFETPEKVFVVMEKL
HGDMLEMILSSEKGRLPERLTKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFAR
IIGEKSFRRSVVGTPAYLAPEVLLNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDINDQIQNAAFMYPA
SPWSHISAGAIDLINNLLQVKMRKRYSVDKSLSHPWLQEYQTWLDLRELEGKMGERYITHESDDARWEQF
AAEHPLPGSGLPTDRDLGGACPPQDHDMQGLAERISVL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057541
RefSeq Size 2883
RefSeq ORF 2634
Synonyms HSPC187; nPKC-D2; PKD2
Locus ID 25865
UniProt ID Q9BZL6
Cytogenetics 19q13.32
Summary The protein encoded by this gene belongs to the protein kinase D (PKD) family of serine/threonine protein kinases. This kinase can be activated by phorbol esters as well as by gastrin via the cholecystokinin B receptor (CCKBR) in gastric cancer cells. It can bind to diacylglycerol (DAG) in the trans-Golgi network (TGN) and may regulate basolateral membrane protein exit from TGN. Alternative splicing results in multiple transcript variants encoding different isoforms. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Protein Kinase
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Protein Kinase D2" proteins (11)
SKU Description Size Price
PH321442 PRKD2 MS Standard C13 and N15-labeled recombinant protein (NP_001073349) 10 ug
$3,360.00
PH321498 PRKD2 MS Standard C13 and N15-labeled recombinant protein (NP_001073350) 10 ug
$3,360.00
LC402555 Lyophilized PRKD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421574 Lyophilized PRKD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421575 Lyophilized PRKD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402555 Transient overexpression lysate of protein kinase D2 (PRKD2), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY421574 Transient overexpression lysate of protein kinase D2 (PRKD2), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY421575 Transient overexpression lysate of protein kinase D2 (PRKD2), transcript variant 3 (as WB positive control) 100 ug
$665.00
TP315335 Recombinant protein of human protein kinase D2 (PRKD2), transcript variant 1, 20 µg 20 ug
$867.00
TP321442 Recombinant protein of human protein kinase D2 (PRKD2), transcript variant 2, 20 µg 20 ug
$867.00
TP321498 Recombinant protein of human protein kinase D2 (PRKD2), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products