Protein Kinase D2 (PRKD2) (NM_001079880) Human Recombinant Protein

SKU
TP321442
Recombinant protein of human protein kinase D2 (PRKD2), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC221442 representing NM_001079880
Red=Cloning site Green=Tags(s)

MATAPSYPAGLPGSPGPGSPPPPGGLELQSPPPLLPQIPAPGSGVSFHIQIGLTREFVLLPAASELAHVK
QLACSIVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSSGDIQEGDLVEVVLSASATFEDFQIRPHA
LTVHSYRAPAFCDHCGEMLFGLVRQGLKCDGCGLNYHKRCAFSIPNNCSGARKRRLSSTSLASGHSVRLG
TSESLPCTAEELSRSTTELLPRRPPSSSSSSSASSYTGRPIELDKMLLSKVKVPHTFLIHSYTRPTVCQA
CKKLLKGLFRQGLQCKDCKFNCHKRCATRVPNDCLGEALINGDVPMEEATDFSEADKSALMDESEDSGVI
PGSHSENALHASEEEEGEGGKAQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYWR
LDCKCITLFQNNTTNRYYKEIPLSEILTVESAQNFSLVPPGTNPHCFEIVTANATYFVGEMPGGTPGGPS
GQGAEAARGWETAIRQALMPVILQDAPSAPGHAPHRQASLSISVSNSQIQENVDIATVYQIFPDEVLGSG
QFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRNEVAILQSLRHPGIVNLECMFETPEKVFVVMEKL
HGDMLEMILSSEKGRLPERLTKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFAR
IIGEKSFRRSVVGTPAYLAPEVLLNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDINDQIQNAAFMYPA
SPWSHISAGAIDLINNLLQVKMRKRYSVDKSLSHPWLQEYQTWLDLRELEGKMGERYITHESDDARWEQF
AAEHPLPGSGLPTDRDLGGACPPQDHDMQGLAERISVL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 96.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001073349
Locus ID 25865
UniProt ID Q9BZL6
Cytogenetics 19q13.32
RefSeq Size 3338
RefSeq ORF 2634
Synonyms HSPC187; nPKC-D2; PKD2
Summary The protein encoded by this gene belongs to the protein kinase D (PKD) family of serine/threonine protein kinases. This kinase can be activated by phorbol esters as well as by gastrin via the cholecystokinin B receptor (CCKBR) in gastric cancer cells. It can bind to diacylglycerol (DAG) in the trans-Golgi network (TGN) and may regulate basolateral membrane protein exit from TGN. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protein Kinase
Write Your Own Review
You're reviewing:Protein Kinase D2 (PRKD2) (NM_001079880) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH315335 PRKD2 MS Standard C13 and N15-labeled recombinant protein (NP_057541) 10 ug
$3,255.00
PH321442 PRKD2 MS Standard C13 and N15-labeled recombinant protein (NP_001073349) 10 ug
$3,255.00
PH321498 PRKD2 MS Standard C13 and N15-labeled recombinant protein (NP_001073350) 10 ug
$3,255.00
LC402555 PRKD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421574 PRKD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421575 PRKD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402555 Transient overexpression lysate of protein kinase D2 (PRKD2), transcript variant 1 100 ug
$665.00
LY421574 Transient overexpression lysate of protein kinase D2 (PRKD2), transcript variant 2 100 ug
$665.00
LY421575 Transient overexpression lysate of protein kinase D2 (PRKD2), transcript variant 3 100 ug
$665.00
TP315335 Recombinant protein of human protein kinase D2 (PRKD2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP321498 Recombinant protein of human protein kinase D2 (PRKD2), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.