Protein Kinase D2 (PRKD2) (NM_001079880) Human Mass Spec Standard

SKU
PH321442
PRKD2 MS Standard C13 and N15-labeled recombinant protein (NP_001073349)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC221442]
Predicted MW 96.5 kDa
Protein Sequence
Protein Sequence
>RC221442 representing NM_001079880
Red=Cloning site Green=Tags(s)

MATAPSYPAGLPGSPGPGSPPPPGGLELQSPPPLLPQIPAPGSGVSFHIQIGLTREFVLLPAASELAHVK
QLACSIVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSSGDIQEGDLVEVVLSASATFEDFQIRPHA
LTVHSYRAPAFCDHCGEMLFGLVRQGLKCDGCGLNYHKRCAFSIPNNCSGARKRRLSSTSLASGHSVRLG
TSESLPCTAEELSRSTTELLPRRPPSSSSSSSASSYTGRPIELDKMLLSKVKVPHTFLIHSYTRPTVCQA
CKKLLKGLFRQGLQCKDCKFNCHKRCATRVPNDCLGEALINGDVPMEEATDFSEADKSALMDESEDSGVI
PGSHSENALHASEEEEGEGGKAQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYWR
LDCKCITLFQNNTTNRYYKEIPLSEILTVESAQNFSLVPPGTNPHCFEIVTANATYFVGEMPGGTPGGPS
GQGAEAARGWETAIRQALMPVILQDAPSAPGHAPHRQASLSISVSNSQIQENVDIATVYQIFPDEVLGSG
QFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRNEVAILQSLRHPGIVNLECMFETPEKVFVVMEKL
HGDMLEMILSSEKGRLPERLTKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFAR
IIGEKSFRRSVVGTPAYLAPEVLLNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDINDQIQNAAFMYPA
SPWSHISAGAIDLINNLLQVKMRKRYSVDKSLSHPWLQEYQTWLDLRELEGKMGERYITHESDDARWEQF
AAEHPLPGSGLPTDRDLGGACPPQDHDMQGLAERISVL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001073349
RefSeq Size 3338
RefSeq ORF 2634
Synonyms HSPC187; nPKC-D2; PKD2
Locus ID 25865
UniProt ID Q9BZL6
Cytogenetics 19q13.32
Summary The protein encoded by this gene belongs to the protein kinase D (PKD) family of serine/threonine protein kinases. This kinase can be activated by phorbol esters as well as by gastrin via the cholecystokinin B receptor (CCKBR) in gastric cancer cells. It can bind to diacylglycerol (DAG) in the trans-Golgi network (TGN) and may regulate basolateral membrane protein exit from TGN. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protein Kinase
Write Your Own Review
You're reviewing:Protein Kinase D2 (PRKD2) (NM_001079880) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH315335 PRKD2 MS Standard C13 and N15-labeled recombinant protein (NP_057541) 10 ug
$3,255.00
PH321498 PRKD2 MS Standard C13 and N15-labeled recombinant protein (NP_001073350) 10 ug
$3,255.00
LC402555 PRKD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421574 PRKD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421575 PRKD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402555 Transient overexpression lysate of protein kinase D2 (PRKD2), transcript variant 1 100 ug
$665.00
LY421574 Transient overexpression lysate of protein kinase D2 (PRKD2), transcript variant 2 100 ug
$665.00
LY421575 Transient overexpression lysate of protein kinase D2 (PRKD2), transcript variant 3 100 ug
$665.00
TP315335 Recombinant protein of human protein kinase D2 (PRKD2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP321442 Recombinant protein of human protein kinase D2 (PRKD2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP321498 Recombinant protein of human protein kinase D2 (PRKD2), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.