PTCD2 (NM_024754) Human Mass Spec Standard

CAT#: PH315253

PTCD2 MS Standard C13 and N15-labeled recombinant protein (NP_079030)

Product Images

Coomassie blue staining of purified PTCD2 protein (Cat# TP315253). The protein was produced from HEK293T cells transfected with PTCD2 cDNA clone (Cat# RC215253) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215253
• Predicted MW: 43.8 kDa
• Protein Sequence:
  Sequence Link

  >RC215253 representing NM_024754
  Red=Cloning site Green=Tags(s)
  
  MVRDSMAAAFRPSNRVLLQALQILVYPGVGGSGSVSCRCPLGAKRYLLTDNVVKLKEFQQKKVAVACNLS
  GTKETYFRNLKKKLTQNKLILKGELITLLHLCESRDHVELAKNVIYRYHAENKNFTLGEYKFGPLFVRLC
  YELDLEESAVELMKDQHLRGFFSDSTSFNILMDMLFIKGKYKSALQVLIEMKNQDVKFTKDTYVLAFAIC
  YKLNSPESFKICTTLREEALLKGEILSRRASCFAVALALNQNEMAKAVSIFSQIMNPESIACINLNIIIH
  IQSNMLENLIKTLKNAAEGNLSKFVKRHVFSEEVLAKVREKVKDVPALVAKFDEIYGTLHITGQVTTDSL
  DAVLCHTPRDRKSHTLLLNKRMVSRRTFQPLSQSLLAE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_079030
• RefSeq Size: 2103
• RefSeq ORF: 1164
• Locus ID: 79810
• UniProt ID: Q8WV60, A0A024RAM6, B3KPU6
• Cytogenetics: 5q13.2
• Summary: Involved in mitochondrial RNA maturation and mitochondrial respiratory chain function.[UniProtKB/Swiss-Prot Function]