PTCD2 Rabbit Polyclonal Antibody

SKU TA331734

Rabbit Polyclonal Anti-PTCD2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PTCD2 Antibody is: synthetic peptide directed towards the N-terminal region of Human PTCD2. Synthetic peptide located within the following region: AVACNLSGTKETYFRNLKKKLTQNKLILKGELITLLHLCESRDHVELAKN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 43 kDa
• Gene Name: pentatricopeptide repeat domain 2
• Database Link:
  NP_079030
  Q8WV60
• Background: PTCD2 is involved in mitochondrial RNA maturation and mitochondrial respiratory chain function.
• Synonyms: FLJ12598
• Note: Immunogen sequence homology: Human: 100%; Rabbit: 100%; Rat: 91%; Pig: 90%; Mouse: 90%; Guinea pig: 90%

Reference Data