OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PTCD2 (NM_024754) Human Mass Spec Standard

Be the first to review this product
SKU
PH315253
PTCD2 MS Standard C13 and N15-labeled recombinant protein (NP_079030)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA331734 Rabbit Polyclonal Anti-PTCD2 Antibody
100 ul
$585.00
LY403024 Transient overexpression lysate of pentatricopeptide repeat domain 2 (PTCD2) (as WB positive control) 100 ug
$436.00

Other products for "PTCD2 or NM_024754"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC215253
Predicted MW 43.8 kDa
Protein Sequence
Protein Sequence
>RC215253 representing NM_024754
Red=Cloning site Green=Tags(s)

MVRDSMAAAFRPSNRVLLQALQILVYPGVGGSGSVSCRCPLGAKRYLLTDNVVKLKEFQQKKVAVACNLS
GTKETYFRNLKKKLTQNKLILKGELITLLHLCESRDHVELAKNVIYRYHAENKNFTLGEYKFGPLFVRLC
YELDLEESAVELMKDQHLRGFFSDSTSFNILMDMLFIKGKYKSALQVLIEMKNQDVKFTKDTYVLAFAIC
YKLNSPESFKICTTLREEALLKGEILSRRASCFAVALALNQNEMAKAVSIFSQIMNPESIACINLNIIIH
IQSNMLENLIKTLKNAAEGNLSKFVKRHVFSEEVLAKVREKVKDVPALVAKFDEIYGTLHITGQVTTDSL
DAVLCHTPRDRKSHTLLLNKRMVSRRTFQPLSQSLLAE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079030
RefSeq Size 2103
RefSeq ORF 1164
Locus ID 79810
UniProt ID Q8WV60
Cytogenetics 5q13.2
Summary Involved in mitochondrial RNA maturation and mitochondrial respiratory chain function.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PTCD2" proteins (3)
SKU Description Size Price
LC403024 Lyophilized PTCD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403024 Transient overexpression lysate of pentatricopeptide repeat domain 2 (PTCD2) (as WB positive control) 100 ug
$436.00
TP315253 Recombinant protein of human pentatricopeptide repeat domain 2 (PTCD2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products