RBP1 (NM_002899) Human Mass Spec Standard

CAT#: PH314515

RBP1 MS Standard C13 and N15-labeled recombinant protein (NP_002890)

Product Images

Coomassie blue staining of purified RBP1 protein (Cat# TP314515). The protein was produced from HEK293T cells transfected with RBP1 cDNA clone (Cat# RC214515) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214515
• Predicted MW: 15.7 kDa
• Protein Sequence:
  Sequence Link

  >RC214515 representing NM_002899
  Red=Cloning site Green=Tags(s)
  
  MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKE
  FEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002890
• RefSeq Size: 720
• RefSeq ORF: 405
• Synonyms: CRABP-I; CRBP; CRBP1; CRBPI; RBPC
• Locus ID: 5947
• UniProt ID: P09455, A0A0A0MQT0
• Cytogenetics: 3q23
• Summary: This gene encodes the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]