OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SMYD2 (NM_020197) Human Mass Spec Standard

Be the first to review this product
SKU
PH314307
SMYD2 MS Standard C13 and N15-labeled recombinant protein (NP_064582)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA351942 Rabbit Polyclonal Anti-SMYD2 Antibody
100 ul
$205.00
LY412619 Transient overexpression lysate of SET and MYND domain containing 2 (SMYD2) (as WB positive control) 100 ug
$665.00

Other products for "SMYD2 or NM_020197"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC214307
Predicted MW 49.5 kDa
Protein Sequence
Protein Sequence
>RC214307 representing NM_020197
Red=Cloning site Green=Tags(s)

MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQ
AFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDK
LDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCC
PNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIR
KLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVC
LYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDH
PYISEIKQEIESH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_064582
RefSeq Size 1694
RefSeq ORF 1299
Synonyms HSKM-B; KMT3C; ZMYND14
Locus ID 56950
UniProt ID Q9NRG4
Cytogenetics 1q32.3
Summary SET domain-containing proteins, such as SMYD2, catalyze lysine methylation (Brown et al., 2006 PubMed 16805913).supplied by OMIM, Nov 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SMYD2" proteins (3)
SKU Description Size Price
LC412619 Lyophilized SMYD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412619 Transient overexpression lysate of SET and MYND domain containing 2 (SMYD2) (as WB positive control) 100 ug
$665.00
TP314307 Recombinant protein of human SET and MYND domain containing 2 (SMYD2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products