SCML1 (NM_001037535) Human Mass Spec Standard

CAT#: PH314112

SCML1 MS Standard C13 and N15-labeled recombinant protein (NP_001032624)

Product Images

Coomassie blue staining of purified SCML1 protein (Cat# TP314112). The protein was produced from HEK293T cells transfected with SCML1 cDNA clone (Cat# RC214112) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214112
• Predicted MW: 34.22 kDa
• Protein Sequence:
  Sequence Link

  >RC214112 representing NM_001037535
  Red=Cloning site Green=Tags(s)
  
  MMSNSSSEIDVQEPNIVSDASCNTEEQLKTVDDVLIHCQVIYDALQNLDKKIDVIRRKVSKIQRFHARSL
  WTNHKRYGYKKHSYRLVKKLKLQKMKKNEVYETFSYPESYSPTLPVSRRENNSPSNLPRPSFCMEEYQRA
  ELEEDPILSRTPSPVHPSDFSEHNCQPYYASDGATYGSSSGLCLGNPRADSIHNTYSTDHASAAPPSVTR
  SPVENDGYIEEGSITKHPSTWSVEAVVLFLKQTDPLALCPLVDLFRSHEIDGKALLLLTSDVLLKHLGVK
  LGTAVKLCYYIDRLKQGKCFEN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001032624
• RefSeq Size: 2693
• RefSeq ORF: 906
• Locus ID: 6322
• UniProt ID: Q9UN30, A0A024RBY0
• Cytogenetics: Xp22.13
• Summary: Putative Polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. May be involved in spermatogenesis during sexual maturation (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Transcription Factors