SCML1 Rabbit Polyclonal Antibody

SKU TA339137

Rabbit Polyclonal Anti-SCML1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SCML1 antibody: synthetic peptide directed towards the middle region of human SCML1. Synthetic peptide located within the following region: ESYSPTLPVSRRENNSPSNLPRPSFCMEEYQRAELEEDPILSRTPSPVHP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 34 kDa
• Gene Name: sex comb on midleg-like 1 (Drosophila)
• Database Link:
  NP_006737
  Q9UN30
• Background: Putative Polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. May be involved in spermatogenesis during sexual maturation.
• Synonyms: SCML1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Horse: 77%

Reference Data

• Protein Families: Transcription Factors