OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

UBE2D3 (NM_181886) Human Mass Spec Standard

Be the first to review this product
SKU
PH313585
UBE2D3 MS Standard C13 and N15-labeled recombinant protein (NP_871615)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA356287 UBE2D3 Antibody - N-terminal region
100 ul
$585.00
LY405574 Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "UBE2D3 or NM_181886"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213585
Predicted MW 16.7 kDa
Protein Sequence
Protein Sequence
>RC213585 representing NM_181886
Red=Cloning site Green=Tags(s)

MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT
TRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISRE
WTQKYAM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_871615
RefSeq Size 4184
RefSeq ORF 441
Synonyms E2(17)KB3; UBC4/5; UBCH5C
Locus ID 7323
UniProt ID P61077
Cytogenetics 4q24
Summary The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. provided by RefSeq, Jan 2017
Protein Pathways Ubiquitin mediated proteolysis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "UBE2D3" proteins (26)
SKU Description Size Price
PH307371 UBE2D3 MS Standard C13 and N15-labeled recombinant protein (NP_003331) 10 ug
$3,360.00
PH313686 UBE2D3 MS Standard C13 and N15-labeled recombinant protein (NP_871618) 10 ug
$3,360.00
PH315841 UBE2D3 MS Standard C13 and N15-labeled recombinant protein (NP_871616) 10 ug
$3,360.00
PH318977 UBE2D3 MS Standard C13 and N15-labeled recombinant protein (NP_871622) 10 ug
$3,360.00
LC405574 Lyophilized UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405575 Lyophilized UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405576 Lyophilized UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405577 Lyophilized UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405578 Lyophilized UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405579 Lyophilized UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405581 Lyophilized UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418758 Lyophilized UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405574 Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY405575 Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY405576 Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY405577 Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 5 (as WB positive control) 100 ug
$436.00
LY405578 Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 6 (as WB positive control) 100 ug
$436.00
LY405579 Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 7 (as WB positive control) 100 ug
$436.00
LY405581 Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 9 (as WB positive control) 100 ug
$436.00
LY418758 Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP307371 Recombinant protein of human ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 1, 20 µg 20 ug
$867.00
TP313585 Purified recombinant protein of Homo sapiens ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 2, 20 µg 20 ug
$867.00
TP313686 Purified recombinant protein of Homo sapiens ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 5, 20 µg 20 ug
$867.00
TP315841 Recombinant protein of human ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 3, 20 µg 20 ug
$867.00
TP318977 Recombinant protein of human ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 9, 20 µg 20 ug
$867.00
TP721151 Purified recombinant protein of Human ubiquitin-conjugating enzyme E2D 3 (UBE2D3), transcript variant 1 10 ug
$160.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products