UBE2D3 (NM_181889) Human Recombinant Protein

SKU
TP313686
Purified recombinant protein of Homo sapiens ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 5, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>Peptide sequence encoded by RC213686
Blue=ORF Red=Cloning site Green=Tag(s)

MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAF
TTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRIS
REWTQKYAM

myc-FLAG tag

Recombinant protein using RC213686 also available, TP313686
Tag C-Myc/DDK
Predicted MW 16.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_871618
Locus ID 7323
UniProt ID P61077
Cytogenetics 4q24
RefSeq Size 3856
RefSeq ORF 443
Synonyms E2(17)KB3; UBC4/5; UBCH5C
Summary The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. [provided by RefSeq, Jan 2017]
Protein Pathways Ubiquitin mediated proteolysis
Write Your Own Review
You're reviewing:UBE2D3 (NM_181889) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH307371 UBE2D3 MS Standard C13 and N15-labeled recombinant protein (NP_003331) 10 ug
$3,255.00
PH313585 UBE2D3 MS Standard C13 and N15-labeled recombinant protein (NP_871615) 10 ug
$3,255.00
PH313686 UBE2D3 MS Standard C13 and N15-labeled recombinant protein (NP_871618) 10 ug
$3,255.00
PH315841 UBE2D3 MS Standard C13 and N15-labeled recombinant protein (NP_871616) 10 ug
$3,255.00
PH318977 UBE2D3 MS Standard C13 and N15-labeled recombinant protein (NP_871622) 10 ug
$3,255.00
LC405574 UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405575 UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405576 UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405577 UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405578 UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405579 UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405581 UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC418758 UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405574 Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 2 100 ug
$436.00
LY405575 Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 3 100 ug
$436.00
LY405576 Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 4 100 ug
$436.00
LY405577 Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 5 100 ug
$436.00
LY405578 Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 6 100 ug
$436.00
LY405579 Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 7 100 ug
$436.00
LY405581 Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 9 100 ug
$436.00
LY418758 Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 1 100 ug
$436.00
TP307371 Recombinant protein of human ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP313585 Purified recombinant protein of Homo sapiens ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP315841 Recombinant protein of human ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP318977 Recombinant protein of human ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 9, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP721151 Purified recombinant protein of Human ubiquitin-conjugating enzyme E2D 3 (UBE2D3), transcript variant 1 10 ug
$155.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.