OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

KChIP2 (KCNIP2) (NM_014591) Human Mass Spec Standard

Be the first to review this product
SKU
PH313131
KCNIP2 MS Standard C13 and N15-labeled recombinant protein (NP_055406)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY406638 Transient overexpression lysate of Kv channel interacting protein 2 (KCNIP2), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "KChIP2 or NM_014591"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213131
Predicted MW 32.3 kDa
Protein Sequence
Protein Sequence
>RC213131 representing NM_014591
Red=Cloning site Green=Tags(s)

MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSEIGRVFRFLGDSSLP
SALAAPASLRPHRPRLLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNE
ENFKQIYSQFFPQGDSSTYATFLFNAFDTNHDGSVSFEDFVAGLSVILRGTVDDRLNWAFNLYDLNKDGC
ITKEEMLDIMKSIYDMMGKYTYPALREEAPREHVESFFQKMDRNKDGVVTIEEFIESCQKDENIMRSMQL
FDNVI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055406
RefSeq Size 2608
RefSeq ORF 855
Synonyms KCHIP2
Locus ID 30819
UniProt ID Q9NS61
Cytogenetics 10q24.32
Summary This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Ion Channels: Other
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "KChIP2" proteins (13)
SKU Description Size Price
PH303823 KCNIP2 MS Standard C13 and N15-labeled recombinant protein (NP_775284) 10 ug
$3,360.00
PH319876 KCNIP2 MS Standard C13 and N15-labeled recombinant protein (NP_775283) 10 ug
$3,360.00
LC406637 Lyophilized KCNIP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406638 Lyophilized KCNIP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406642 Lyophilized KCNIP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC415190 Lyophilized KCNIP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406637 Transient overexpression lysate of Kv channel interacting protein 2 (KCNIP2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY406638 Transient overexpression lysate of Kv channel interacting protein 2 (KCNIP2), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY406642 Transient overexpression lysate of Kv channel interacting protein 2 (KCNIP2), transcript variant 7 (as WB positive control) 100 ug
$436.00
LY415190 Transient overexpression lysate of Kv channel interacting protein 2 (KCNIP2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP303823 Recombinant protein of human Kv channel interacting protein 2 (KCNIP2), transcript variant 3, 20 µg 20 ug
$867.00
TP313131 Recombinant protein of human Kv channel interacting protein 2 (KCNIP2), transcript variant 1, 20 µg 20 ug
$867.00
TP319876 Recombinant protein of human Kv channel interacting protein 2 (KCNIP2), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products