KChIP2 (KCNIP2) (NM_173191) Human Recombinant Protein

SKU
TP319876
Recombinant protein of human Kv channel interacting protein 2 (KCNIP2), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC219876 representing NM_173191
Red=Cloning site Green=Tags(s)

MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSETLAAPASLRPHRPR
LLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGD
SSTYATFLFNAFDTNHDGSVSFEDFVAGLSVILRGTVDDRLNWAFNLYDLNKDGCITKEEMLDIMKSIYD
MMGKYTYPALREEAPREHVESFFQKMDRNKDGVVTIEEFIESCQKDENIMRSMQLFDNVI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 30.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_775283
Locus ID 30819
UniProt ID Q9NS61
Cytogenetics 10q24.32
RefSeq Size 2563
RefSeq ORF 810
Synonyms KCHIP2
Summary This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Ion Channels: Other
Write Your Own Review
You're reviewing:KChIP2 (KCNIP2) (NM_173191) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303823 KCNIP2 MS Standard C13 and N15-labeled recombinant protein (NP_775284) 10 ug
$3,255.00
PH313131 KCNIP2 MS Standard C13 and N15-labeled recombinant protein (NP_055406) 10 ug
$3,255.00
PH319876 KCNIP2 MS Standard C13 and N15-labeled recombinant protein (NP_775283) 10 ug
$3,255.00
LC406637 KCNIP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406638 KCNIP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406642 KCNIP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC415190 KCNIP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406637 Transient overexpression lysate of Kv channel interacting protein 2 (KCNIP2), transcript variant 2 100 ug
$436.00
LY406638 Transient overexpression lysate of Kv channel interacting protein 2 (KCNIP2), transcript variant 3 100 ug
$436.00
LY406642 Transient overexpression lysate of Kv channel interacting protein 2 (KCNIP2), transcript variant 7 100 ug
$436.00
LY415190 Transient overexpression lysate of Kv channel interacting protein 2 (KCNIP2), transcript variant 1 100 ug
$436.00
TP303823 Recombinant protein of human Kv channel interacting protein 2 (KCNIP2), transcript variant 3, 20 µg 20 ug
$867.00
TP313131 Recombinant protein of human Kv channel interacting protein 2 (KCNIP2), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.