OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DTX2 (NM_001102594) Human Mass Spec Standard

Be the first to review this product
SKU
PH312997
DTX2 MS Standard C13 and N15-labeled recombinant protein (NP_001096064)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY420165 Transient overexpression lysate of deltex homolog 2 (Drosophila) (DTX2), transcript variant 4 (as WB positive control) 100 ug
$665.00

Other products for "DTX2 or NM_001102594"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212997
Predicted MW 67.1 kDa
Protein Sequence
Protein Sequence
>RC212997 representing NM_001102594
Red=Cloning site Green=Tags(s)

MAMAPSPSLVQVYTSPAAVAVWEWQDGLGTWHPYSATVCSFIEQQFVQQKGQRFGLGSLAHSIPLGQADP
SLAPYIIDLPSWTQFRQDTGTMRAVRRHLFPQHSAPGRGVVWEWLSDDGSWTAYEASVCDYLEQQVARGN
QLVDLAPLGYNYTVNYTTHTQTNKTSSFCRSVRRQAGPPYPVTTIIAPPGHTGVACSCHQCLSGSRTGPV
SGRYRHSMTNLPAYPVPQHPPHRTASVFGTHQAFAPYNKPSLSGARSAPRLNTTNAWGAAPPSLGSQPLY
RSSLSHLGPQHLPPGSSTSGAVSASLPSGPSSSPGSVPATVPMQMPKPSRVQQALAGMTSVLMSAIGLPV
CLSRAPQPTSPPASRLASKSHGSVKRLRKMSVKGATPKPEPEPEQVIKNYTEELKVPPDEDCIICMEKLS
TASGYSDVTDSKAIGSLAVGHLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKTGTQPQGKMEV
LRFQMSLPGHEDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLELLKVAWKRRL
IFTVGTSSTTGETDTVVWNEIHHKTEMDRNITGHGYPDPNYLQNVLAELAAQGVTEDCLEQQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001096064
RefSeq Size 2715
RefSeq ORF 1866
Synonyms RNF58
Locus ID 113878
UniProt ID Q86UW9
Cytogenetics 7q11.23
Summary DTX2 functions as an E3 ubiquitin ligase (Takeyama et al., 2003 PubMed 12670957).supplied by OMIM, Nov 2009
Protein Families Druggable Genome
Protein Pathways Notch signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DTX2" proteins (13)
SKU Description Size Price
PH303717 DTX2 MS Standard C13 and N15-labeled recombinant protein (NP_065943) 10 ug
$3,360.00
PH313418 DTX2 MS Standard C13 and N15-labeled recombinant protein (NP_001096065) 10 ug
$3,360.00
LC412251 Lyophilized DTX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420163 Lyophilized DTX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420164 Lyophilized DTX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420165 Lyophilized DTX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412251 Transient overexpression lysate of deltex homolog 2 (Drosophila) (DTX2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420163 Transient overexpression lysate of deltex homolog 2 (Drosophila) (DTX2), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY420164 Transient overexpression lysate of deltex homolog 2 (Drosophila) (DTX2), transcript variant 3 (as WB positive control) 100 ug
$665.00
LY420165 Transient overexpression lysate of deltex homolog 2 (Drosophila) (DTX2), transcript variant 4 (as WB positive control) 100 ug
$665.00
TP303717 Recombinant protein of human deltex homolog 2 (Drosophila) (DTX2), transcript variant 1, 20 µg 20 ug
$867.00
TP312997 Purified recombinant protein of Homo sapiens deltex homolog 2 (Drosophila) (DTX2), transcript variant 2, 20 µg 20 ug
$867.00
TP313418 Purified recombinant protein of Homo sapiens deltex homolog 2 (Drosophila) (DTX2), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products