DTX2 (NM_020892) Human Recombinant Protein

SKU
TP303717
Recombinant protein of human deltex homolog 2 (Drosophila) (DTX2), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203717 protein sequence
Red=Cloning site Green=Tags(s)

MAMAPSPSLVQVYTSPAAVAVWEWQDGLGTWHPYSATVCSFIEQQFVQQKGQRFGLGSLAHSIPLGQADP
SLAPYIIDLPSWTQFRQDTGTMRAVRRHLFPQHSAPGRGVVWEWLSDDGSWTAYEASVCDYLEQQVARGN
QLVDLAPLGYNYTVNYTTHTQTNKTSSFCRSVRRQAGPPYPVTTIIAPPGHTGVACSCHQCLSGSRTGPV
SGRYRHSMTNLPAYPVPQHPPHRTASVFGTHQAFAPYNKPSLSGARSAPRLNTTNAWGAAPPSLGSQPLY
RSSLSHLGPQHLPPGSSTSGAVSASLPSGPSSSPGSVPATVPMQMPKPSRVQQALAGMTSVLMSAIGLPV
CLSRAPQPTSPPASRLASKSHGSVKRLRKMSVKGATPKPEPEPEQVIKNYTEELKVPPDEDCIICMEKLS
AASGYSDVTDSKAIGSLAVGHLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKTGTQPQGKMEV
LRFQMSLPGHEDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLELLKVAWKRRL
IFTVGTSSTTGETDTVVWNEIHHKTEMDRNITGHGYPDPNYLQNVLAELAAQGVTEDCLEQQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 67.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_065943
Locus ID 113878
UniProt ID Q86UW9
Cytogenetics 7q11.23
RefSeq Size 2835
RefSeq ORF 1866
Synonyms RNF58
Summary DTX2 functions as an E3 ubiquitin ligase (Takeyama et al., 2003 [PubMed 12670957]).[supplied by OMIM, Nov 2009]
Protein Families Druggable Genome
Protein Pathways Notch signaling pathway
Write Your Own Review
You're reviewing:DTX2 (NM_020892) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303717 DTX2 MS Standard C13 and N15-labeled recombinant protein (NP_065943) 10 ug
$3,255.00
PH312997 DTX2 MS Standard C13 and N15-labeled recombinant protein (NP_001096064) 10 ug
$3,255.00
PH313418 DTX2 MS Standard C13 and N15-labeled recombinant protein (NP_001096065) 10 ug
$3,255.00
LC412251 DTX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420163 DTX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420164 DTX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420165 DTX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412251 Transient overexpression lysate of deltex homolog 2 (Drosophila) (DTX2), transcript variant 1 100 ug
$436.00
LY420163 Transient overexpression lysate of deltex homolog 2 (Drosophila) (DTX2), transcript variant 2 100 ug
$665.00
LY420164 Transient overexpression lysate of deltex homolog 2 (Drosophila) (DTX2), transcript variant 3 100 ug
$665.00
LY420165 Transient overexpression lysate of deltex homolog 2 (Drosophila) (DTX2), transcript variant 4 100 ug
$665.00
TP312997 Purified recombinant protein of Homo sapiens deltex homolog 2 (Drosophila) (DTX2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP313418 Purified recombinant protein of Homo sapiens deltex homolog 2 (Drosophila) (DTX2), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.