DTX2 (NM_020892) Human Mass Spec Standard

SKU
PH303717
DTX2 MS Standard C13 and N15-labeled recombinant protein (NP_065943)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203717]
Predicted MW 67.2 kDa
Protein Sequence
Protein Sequence
>RC203717 protein sequence
Red=Cloning site Green=Tags(s)

MAMAPSPSLVQVYTSPAAVAVWEWQDGLGTWHPYSATVCSFIEQQFVQQKGQRFGLGSLAHSIPLGQADP
SLAPYIIDLPSWTQFRQDTGTMRAVRRHLFPQHSAPGRGVVWEWLSDDGSWTAYEASVCDYLEQQVARGN
QLVDLAPLGYNYTVNYTTHTQTNKTSSFCRSVRRQAGPPYPVTTIIAPPGHTGVACSCHQCLSGSRTGPV
SGRYRHSMTNLPAYPVPQHPPHRTASVFGTHQAFAPYNKPSLSGARSAPRLNTTNAWGAAPPSLGSQPLY
RSSLSHLGPQHLPPGSSTSGAVSASLPSGPSSSPGSVPATVPMQMPKPSRVQQALAGMTSVLMSAIGLPV
CLSRAPQPTSPPASRLASKSHGSVKRLRKMSVKGATPKPEPEPEQVIKNYTEELKVPPDEDCIICMEKLS
AASGYSDVTDSKAIGSLAVGHLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKTGTQPQGKMEV
LRFQMSLPGHEDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLELLKVAWKRRL
IFTVGTSSTTGETDTVVWNEIHHKTEMDRNITGHGYPDPNYLQNVLAELAAQGVTEDCLEQQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065943
RefSeq Size 2835
RefSeq ORF 1866
Synonyms RNF58
Locus ID 113878
UniProt ID Q86UW9
Cytogenetics 7q11.23
Summary DTX2 functions as an E3 ubiquitin ligase (Takeyama et al., 2003 [PubMed 12670957]).[supplied by OMIM, Nov 2009]
Protein Families Druggable Genome
Protein Pathways Notch signaling pathway
Write Your Own Review
You're reviewing:DTX2 (NM_020892) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH312997 DTX2 MS Standard C13 and N15-labeled recombinant protein (NP_001096064) 10 ug
$3,255.00
PH313418 DTX2 MS Standard C13 and N15-labeled recombinant protein (NP_001096065) 10 ug
$3,255.00
LC412251 DTX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420163 DTX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420164 DTX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420165 DTX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412251 Transient overexpression lysate of deltex homolog 2 (Drosophila) (DTX2), transcript variant 1 100 ug
$436.00
LY420163 Transient overexpression lysate of deltex homolog 2 (Drosophila) (DTX2), transcript variant 2 100 ug
$665.00
LY420164 Transient overexpression lysate of deltex homolog 2 (Drosophila) (DTX2), transcript variant 3 100 ug
$665.00
LY420165 Transient overexpression lysate of deltex homolog 2 (Drosophila) (DTX2), transcript variant 4 100 ug
$665.00
TP303717 Recombinant protein of human deltex homolog 2 (Drosophila) (DTX2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP312997 Purified recombinant protein of Homo sapiens deltex homolog 2 (Drosophila) (DTX2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP313418 Purified recombinant protein of Homo sapiens deltex homolog 2 (Drosophila) (DTX2), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.