OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LRRN4CL (NM_203422) Human Mass Spec Standard

Be the first to review this product
SKU
PH312939
LRRN4CL MS Standard C13 and N15-labeled recombinant protein (NP_981967)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA333320 Rabbit Polyclonal Anti-LRRN4CL Antibody
100 ul
$585.00
LY404286 Transient overexpression lysate of LRRN4 C-terminal like (LRRN4CL) (as WB positive control) 100 ug
$436.00

Other products for "LRRN4CL or NM_203422"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212939
Predicted MW 25.1 kDa
Protein Sequence
Protein Sequence
>RC212939 representing NM_203422
Red=Cloning site Green=Tags(s)

MLGSPCLLWLLAVTFLVPRAQPLAPQDFEEEEADETETAWPPLPAVPCDYDHCRHLQVPCKELQRVGPAA
CLCPGLSSPAQPPDPPRMGEVRIAAEEGRAVVHWCAPFSPVLHYWLLLWDGSEAAQKGPPLNATVRRAEL
KGLKPGGIYVVCVVAANEAGASRVPQAGGEGLEGADIPAFGPCSRLAVPPNPRTLVHAAVGVGTALALLS
CAALVWHFCLRDRWGCPRRAAARAAGAL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_981967
RefSeq Size 2429
RefSeq ORF 714
Locus ID 221091
UniProt ID Q8ND94
Cytogenetics 11q12.3
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LRRN4CL" proteins (3)
SKU Description Size Price
LC404286 Lyophilized LRRN4CL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404286 Transient overexpression lysate of LRRN4 C-terminal like (LRRN4CL) (as WB positive control) 100 ug
$436.00
TP312939 Purified recombinant protein of Homo sapiens LRRN4 C-terminal like (LRRN4CL), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products