LRRN4CL (NM_203422) Human Recombinant Protein

SKU
TP312939
Purified recombinant protein of Homo sapiens LRRN4 C-terminal like (LRRN4CL), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC212939 representing NM_203422
Red=Cloning site Green=Tags(s)

MLGSPCLLWLLAVTFLVPRAQPLAPQDFEEEEADETETAWPPLPAVPCDYDHCRHLQVPCKELQRVGPAA
CLCPGLSSPAQPPDPPRMGEVRIAAEEGRAVVHWCAPFSPVLHYWLLLWDGSEAAQKGPPLNATVRRAEL
KGLKPGGIYVVCVVAANEAGASRVPQAGGEGLEGADIPAFGPCSRLAVPPNPRTLVHAAVGVGTALALLS
CAALVWHFCLRDRWGCPRRAAARAAGAL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 25.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_981967
Locus ID 221091
UniProt ID Q8ND94
Cytogenetics 11q12.3
RefSeq Size 2429
RefSeq ORF 714
Protein Families Transmembrane
Write Your Own Review
You're reviewing:LRRN4CL (NM_203422) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH312939 LRRN4CL MS Standard C13 and N15-labeled recombinant protein (NP_981967) 10 ug
$3,255.00
LC404286 LRRN4CL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404286 Transient overexpression lysate of LRRN4 C-terminal like (LRRN4CL) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.