PID1 (NM_001100818) Human Mass Spec Standard

CAT#: PH312505

PID1 MS Standard C13 and N15-labeled recombinant protein (NP_001094288)

Product Images

Coomassie blue staining of purified PID1 protein (Cat# TP312505). The protein was produced from HEK293T cells transfected with PID1 cDNA clone (Cat# RC212505) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212505
• Predicted MW: 24.6 kDa
• Protein Sequence:
  Sequence Link

  >RC212505 representing NM_001100818
  Red=Cloning site Green=Tags(s)
  
  MWQPATERLQHFQTMLKSKLNVLTLKKEPLPAVIFHEPEAIELCTTTPLMKTRTHSGCKVTYLGKVSTTG
  MQFLSGCTEKPVIELWKKHTLAREDVFPANALLEIRPFQVWLHHLDHKGEATVHMDTFQVARIAYCTADH
  NVSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKKLAHAMMEAFRKTFHSMKSDGRIHSNSSSEEVSQ
  ELESDDG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001094288
• RefSeq Size: 2626
• RefSeq ORF: 651
• Synonyms: HMFN2073; NYGGF4; P-CLI1; PCLI1
• Locus ID: 55022
• UniProt ID: Q7Z2X4
• Cytogenetics: 2q36.3
• Summary: Increases proliferation of preadipocytes without affecting adipocytic differentiation.[UniProtKB/Swiss-Prot Function]